GGRNA Home | Help | Advanced search

2024-04-26 07:50:22, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001160333            2509 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens neurofascin (NFASC), transcript variant 6, mRNA.
ACCESSION   NM_001160333
VERSION     NM_001160333.1  GI:237858681
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2509)
  AUTHORS   Shaffer,J.R., Feingold,E., Wang,X., Lee,M., Tcuenco,K., Weeks,D.E.,
            Weyant,R.J., Crout,R., McNeil,D.W. and Marazita,M.L.
  TITLE     GWAS of dental caries patterns in the permanent dentition
  JOURNAL   J. Dent. Res. 92 (1), 38-44 (2013)
   PUBMED   23064961
REFERENCE   2  (bases 1 to 2509)
  AUTHORS   Sistani,L., Rodriguez,P.Q., Hultenby,K., Uhlen,M., Betsholtz,C.,
            Jalanko,H., Tryggvason,K., Wernerson,A. and Patrakka,J.
  TITLE     Neuronal proteins are novel components of podocyte major processes
            and their expression in glomerular crescents supports their role in
            crescent formation
  JOURNAL   Kidney Int. 83 (1), 63-71 (2013)
   PUBMED   22913984
  REMARK    GeneRIF: Three neuronal proteins (Huntingtin interacting protein 1,
            neurofascin, and olfactomedin-like 2a) are novel components of
            podocyte major processes and their expression in glomerular
            crescents supports their role in crescent formation.
REFERENCE   3  (bases 1 to 2509)
  AUTHORS   Buttermore,E.D., Piochon,C., Wallace,M.L., Philpot,B.D., Hansel,C.
            and Bhat,M.A.
  TITLE     Pinceau organization in the cerebellum requires distinct functions
            of neurofascin in Purkinje and basket neurons during postnatal
            development
  JOURNAL   J. Neurosci. 32 (14), 4724-4742 (2012)
   PUBMED   22492029
  REMARK    GeneRIF: Cerebellar pinceau organization requires coordinated
            mechanisms involving specific neurofascin functions in both
            Purkinje and basket neurons.
REFERENCE   4  (bases 1 to 2509)
  AUTHORS   Devaux,J.J., Odaka,M. and Yuki,N.
  TITLE     Nodal proteins are target antigens in Guillain-Barre syndrome
  JOURNAL   J. Peripher. Nerv. Syst. 17 (1), 62-71 (2012)
   PUBMED   22462667
  REMARK    GeneRIF: gliomedin, NF186, and contactin are novel target antigens
            in Guillain-Barre syndrome
REFERENCE   5  (bases 1 to 2509)
  AUTHORS   Tuvia,S., Garver,T.D. and Bennett,V.
  TITLE     The phosphorylation state of the FIGQY tyrosine of neurofascin
            determines ankyrin-binding activity and patterns of cell
            segregation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 94 (24), 12957-12962 (1997)
   PUBMED   9371782
REFERENCE   6  (bases 1 to 2509)
  AUTHORS   Davis,J.Q., Lambert,S. and Bennett,V.
  TITLE     Molecular composition of the node of Ranvier: identification of
            ankyrin-binding cell adhesion molecules neurofascin (mucin+/third
            FNIII domain-) and NrCAM at nodal axon segments
  JOURNAL   J. Cell Biol. 135 (5), 1355-1367 (1996)
   PUBMED   8947556
REFERENCE   7  (bases 1 to 2509)
  AUTHORS   Volkmer,H., Leuschner,R., Zacharias,U. and Rathjen,F.G.
  TITLE     Neurofascin induces neurites by heterophilic interactions with
            axonal NrCAM while NrCAM requires F11 on the axonal surface to
            extend neurites
  JOURNAL   J. Cell Biol. 135 (4), 1059-1069 (1996)
   PUBMED   8922386
REFERENCE   8  (bases 1 to 2509)
  AUTHORS   Hortsch,M.
  TITLE     The L1 family of neural cell adhesion molecules: old proteins
            performing new tricks
  JOURNAL   Neuron 17 (4), 587-593 (1996)
   PUBMED   8893017
  REMARK    Review article
REFERENCE   9  (bases 1 to 2509)
  AUTHORS   Burmeister,M., Ren,Q., Makris,G.J., Samson,D. and Bennett,V.
  TITLE     Genes for the neuronal immunoglobulin domain cell adhesion
            molecules neurofascin and Nr-CAM map to mouse chromosomes 1 and 12
            and homologous human chromosomes
  JOURNAL   Mamm. Genome 7 (7), 558-559 (1996)
   PUBMED   8672144
REFERENCE   10 (bases 1 to 2509)
  AUTHORS   Volkmer,H., Hassel,B., Wolff,J.M., Frank,R. and Rathjen,F.G.
  TITLE     Structure of the axonal surface recognition molecule neurofascin
            and its relationship to a neural subgroup of the immunoglobulin
            superfamily
  JOURNAL   J. Cell Biol. 118 (1), 149-161 (1992)
   PUBMED   1377696
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC040674.1, AK299262.1,
            AK090639.1 and AA514945.1.
            
            Summary: This gene encodes an L1 family immunoglobulin cell
            adhesion molecule with multiple IGcam and fibronectin domains. The
            protein functions in neurite outgrowth, neurite fasciculation, and
            organization of the axon initial segment (AIS) and nodes of Ranvier
            on axons during early development. Both the AIS and nodes of
            Ranvier contain high densities of voltage-gated Na+ (Nav) channels
            which are clustered by interactions with cytoskeletal and
            scaffolding proteins including this protein, gliomedin, ankyrin 3
            (ankyrin-G), and betaIV spectrin. This protein links the AIS
            extracellular matrix to the intracellular cytoskeleton. This gene
            undergoes extensive alternative splicing, and the full-length
            nature of some variants has not been determined.[provided by
            RefSeq, May 2009].
            
            Transcript Variant: This variant (6) lacks the second coding exon
            and uses an alternate 3' coding region and 3' UTR, compared to
            variant 1. The resulting isoform (5) lacks an internal domain and
            has a substantially shorter and distinct C-terminus that lacks the
            fibronectin domains, compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK299262.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025083 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            CDS uses downstream in-frame AUG :: downstream AUG is associated
                                                with N-terminal localization
                                                signal
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-21                BC040674.1         6-26
            22-1863             AK299262.1         1-1842
            1864-2485           AK090639.1         1841-2462
            2486-2509           AA514945.1         1-24                c
FEATURES             Location/Qualifiers
     source          1..2509
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q32.1"
     gene            1..2509
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="neurofascin"
                     /db_xref="GeneID:23114"
                     /db_xref="HGNC:29866"
                     /db_xref="MIM:609145"
     exon            1..129
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     exon            130..238
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       145
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184776653"
     variation       195
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142757146"
     variation       217
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12128657"
     exon            239..419
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       243
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79130984"
     variation       282
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368003381"
     variation       307
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201417276"
     variation       310
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372878722"
     CDS             329..2170
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="isoform 6 precursor is encoded by transcript
                     variant 6; neurofascin homolog"
                     /codon_start=1
                     /product="neurofascin isoform 6 precursor"
                     /protein_id="NP_001153805.1"
                     /db_xref="GI:237858682"
                     /db_xref="GeneID:23114"
                     /db_xref="HGNC:29866"
                     /db_xref="MIM:609145"
                     /translation="
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDLTQPPTITKQSAKDHIVDPRDNILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGNCPCSPWH
"
     sig_peptide     329..400
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     401..2167
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /product="neurofascin isoform 6"
     misc_feature    431..718
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:191810"
     misc_feature    485..715
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Sixth immunoglobulin (Ig)-like domain of human
                     neurofascin (NF); Region: Ig6_hNeurofascin_like; cd05875"
                     /db_xref="CDD:143283"
     misc_feature    728..1006
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:213125"
     misc_feature    1091..1309
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:191810"
     misc_feature    1100..1312
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Third immunoglobulin (Ig)-like domain of the L1
                     cell adhesion molecule (CAM); Region: Ig3_L1-CAM_like;
                     cd05731"
                     /db_xref="CDD:143208"
     misc_feature    1319..1585
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:191810"
     misc_feature    1361..1588
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Fourth immunoglobulin (Ig)-like domain of L1,
                     Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM
                     (Ng-CAM-related); Region: Ig4_L1-NrCAM_like; cd04978"
                     /db_xref="CDD:143179"
     misc_feature    1655..1834
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Immunoglobulin C-2 Type; Region: IGc2; smart00408"
                     /db_xref="CDD:197706"
     misc_feature    1892..2137
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:191810"
     misc_feature    1892..2137
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /note="Immunoglobulin; Region: IG; smart00409"
                     /db_xref="CDD:197707"
     variation       345
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147777257"
     variation       349
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149873707"
     variation       350
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375852982"
     variation       367
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149111254"
     variation       394
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138639366"
     variation       395
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145678100"
     variation       419
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375813060"
     exon            420..525
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       424
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111823167"
     variation       430
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141859066"
     variation       443
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138945016"
     variation       467
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188580609"
     exon            526..722
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       562
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375752918"
     variation       576
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144793383"
     variation       601
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139082842"
     variation       605
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:145530574"
     variation       616
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147387188"
     variation       628
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142536240"
     variation       636
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149736553"
     variation       637
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202239718"
     variation       681
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374043011"
     variation       688
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140357522"
     variation       699
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376957828"
     variation       707
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145437187"
     variation       715
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370974341"
     exon            723..845
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       742
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200777181"
     variation       760
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149151832"
     variation       775
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148289271"
     variation       776
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138530492"
     variation       786
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3795564"
     variation       805
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77635708"
     variation       823
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202108157"
     exon            846..1016
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       861
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199573837"
     variation       862
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148604570"
     variation       873
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374498456"
     variation       892
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368438179"
     variation       913
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371908973"
     variation       937
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374961734"
     variation       955
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200301998"
     variation       973
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61741836"
     variation       977
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142051080"
     variation       992
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199838875"
     exon            1017..1128
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       1035
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374629132"
     variation       1036
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199749786"
     variation       1068
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368489529"
     variation       1069
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190388030"
     variation       1118
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371635013"
     variation       1123
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140997318"
     exon            1129..1313
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       1133
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145749720"
     variation       1146
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148937906"
     variation       1185..1186
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:5780257"
     variation       1209
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201375081"
     variation       1214
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144049714"
     variation       1219
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146782515"
     variation       1238
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150544095"
     variation       1287
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376800898"
     variation       1293
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139508953"
     variation       1294
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369720213"
     variation       1299
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201302248"
     exon            1314..1445
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       1333
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6690894"
     variation       1367
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144130749"
     variation       1368
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372412019"
     variation       1392
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192722996"
     exon            1446..1589
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       1447
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148671147"
     variation       1497
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374469419"
     variation       1570
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61743235"
     exon            1590..1701
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       1596
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367856348"
     variation       1597
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147657218"
     variation       1616
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146896570"
     variation       1640
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138932973"
     variation       1645
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147248519"
     variation       1654
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140756489"
     variation       1655
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184631101"
     variation       1676
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:74923443"
     exon            1702..1868
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       1702
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146893759"
     variation       1721
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146186869"
     variation       1726
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137866492"
     variation       1751
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370227820"
     variation       1759
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202095107"
     variation       1761
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188695414"
     variation       1766
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368738014"
     variation       1788
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372885367"
     variation       1819
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16854838"
     variation       1842
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374505792"
     variation       1847
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371915587"
     variation       1853
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149731085"
     variation       1864
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2246662"
     exon            1869..2016
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       1872
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199525304"
     variation       1886
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377722677"
     variation       1887
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184503324"
     variation       1894
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374003117"
     variation       1895
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202070693"
     variation       1902
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147673215"
     variation       1904
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371036080"
     variation       1911
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56223230"
     variation       1924
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55969362"
     variation       1944
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202061387"
     variation       1950
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374030108"
     variation       1952
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377578078"
     variation       1957
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370657324"
     variation       1967
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138252161"
     variation       1971
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373916599"
     variation       1972
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200842368"
     variation       1998
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137927139"
     variation       2002
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143870626"
     variation       2006
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55778126"
     exon            2017..2492
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /inference="alignment:Splign:1.39.8"
     variation       2032
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:55726173"
     variation       2039
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186193782"
     variation       2089
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17415240"
     variation       2099
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371450457"
     variation       2135
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113197466"
     variation       2152
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6657372"
     variation       2192
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199553059"
     variation       2211
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368097776"
     variation       2260
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:77159058"
     variation       2325
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150050660"
     variation       2371
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189303311"
     variation       2416..2417
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:35570217"
     polyA_signal    2467..2472
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
     polyA_site      2492
                     /gene="NFASC"
                     /gene_synonym="NF; NRCAML"
ORIGIN      
gcacgggctggtctctgccctaatgcggcggctggcggcgagaggcgctgcaggggacgcgggggaagtggcggcgccggcagcggacagctcggacagcgcccagggccggagcccgagcccttggaggttgattgacttatgtgcaatttgggacgctggagtttaccttccctccgcagcctggaacagagcctcctctggtgttgcaaggaagaggctgaatgaggcagagaagctgagtgctgtccaggaggcccagttaaagcggctcgaggtgacaagaccccgagtgctggggagcagggagcagggccaggtgccgaggatggccaggcagccaccgccgccctgggtccatgcagccttcctcctctgcctcctcagtcttggcggagccatcgaaattcctatggatctgacgcagccgccaaccatcaccaagcagtcagcgaaggatcacatcgtggacccccgtgataacatcctgattgagtgtgaagcaaaagggaaccctgcccccagcttccactggacacgaaacagcagattcttcaacatcgccaaggacccccgggtgtccatgaggaggaggtctgggaccctggtgattgacttccgcagtggcgggcggccggaggaatatgagggggaatatcagtgcttcgcccgcaacaaatttggcacggccctgtccaataggatccgcctgcaggtgtctaaatctcctctgtggcccaaggaaaacctagaccctgtcgtggtccaagagggcgctcctttgacgctccagtgcaaccccccgcctggacttccatccccggtcatcttctggatgagcagctccatggagcccatcacccaagacaaacgtgtctctcagggccataacggagacctatacttctccaacgtgatgctgcaggacatgcagaccgactacagttgtaacgcccgcttccacttcacccacaccatccagcagaagaaccctttcaccctcaaggtcctcaccacccgaggagttgcagaaagaacaccaagcttcatgtatccccagggcaccgcgagcagccagatggtgcttcgtggcatggacctcctgctggaatgcatcgcctccggggtcccaacaccagacatcgcatggtacaagaaaggtggggacctcccatctgataaggccaagtttgagaactttaataaggccctgcgtatcacaaatgtctctgaggaagactccggggagtatttctgcctggcctccaacaagatgggcagcatccggcacacgatctcggtgagagtaaaggctgctccctactggctggacgaacccaagaaccttattctggctcctggcgaggatgggagactggtgtgtcgagccaatggaaaccccaaacccactgtccagtggatggtgaatggggaacctttgcaatcggcaccacctaacccaaaccgtgaggtggccggagacaccatcatcttccgggacacccagatcagcagcagggctgtgtaccagtgcaacacctccaacgagcatggctacctgctggccaacgcctttgtcagtgtgctggatgtgccgcctcggatgctgtcgccccggaaccagctcattcgagtgattctttacaaccggacgcggctggactgccctttctttgggtctcccatccccacactgcgatggtttaagaatgggcaaggaagcaacctggatggtggcaactaccatgtttatgagaacggcagtctggaaattaagatgatccgcaaagaggaccagggcatctacacctgtgtcgccaccaacatcctgggcaaagctgaaaaccaagtccgcctggaggtcaaagaccccaccaggatctaccggatgcccgaggaccaggtggccagaaggggcaccacggtgcagctggagtgtcgggtgaagcacgacccctccctgaaactcaccgtctcctggctgaaggatgacgagccgctctatattggaaacaggatgaagaaggaagacgactccctgaccatctttggggtggcagagcgggaccagggcagttacacgtgtgtcgccagcaccgagctagaccaagacctggccaaggcctacctcaccgtgctaggtaactgcccatgctcaccctggcactgaccagccccaccccctccccagcagccagagaagcagtggcccggggcagttccgagggcagtgcctgcagtcaagtggccgggtcaggcgtggtgatctcttcttgcctcgtgatgtcagggttagggagctgccagtttcagaacaagctgtgctggacaggttacctcctgagtggagtcattaacttccccacgtctcaactgaaaggggcctgagtgatatagagaaagtggagaggggtttctcgttgtgatcattttacctttcttacagctaactccaccactaagtcaattaaaacaatccatccttaaagcaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:23114 -> Molecular function: GO:0086080 [protein binding involved in heterotypic cell-cell adhesion] evidence: IEA
            GeneID:23114 -> Biological process: GO:0002175 [protein localization to paranode region of axon] evidence: IEA
            GeneID:23114 -> Biological process: GO:0007411 [axon guidance] evidence: TAS
            GeneID:23114 -> Biological process: GO:0007422 [peripheral nervous system development] evidence: ISS
            GeneID:23114 -> Biological process: GO:0030913 [paranodal junction assembly] evidence: IEA
            GeneID:23114 -> Biological process: GO:0042552 [myelination] evidence: ISS
            GeneID:23114 -> Biological process: GO:0045162 [clustering of voltage-gated sodium channels] evidence: IEA
            GeneID:23114 -> Biological process: GO:0050808 [synapse organization] evidence: IEA
            GeneID:23114 -> Biological process: GO:0071205 [protein localization to juxtaparanode region of axon] evidence: IEA
            GeneID:23114 -> Biological process: GO:0072661 [protein targeting to plasma membrane] evidence: IEA
            GeneID:23114 -> Cellular component: GO:0005622 [intracellular] evidence: ISS
            GeneID:23114 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
            GeneID:23114 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
            GeneID:23114 -> Cellular component: GO:0033010 [paranodal junction] evidence: IEA
            GeneID:23114 -> Cellular component: GO:0033268 [node of Ranvier] evidence: ISS
            GeneID:23114 -> Cellular component: GO:0033268 [node of Ranvier] evidence: TAS
            GeneID:23114 -> Cellular component: GO:0033270 [paranode region of axon] evidence: IEA
            GeneID:23114 -> Cellular component: GO:0043194 [axon initial segment] evidence: ISS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.