2024-04-25 19:49:08, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001159542 1599 bp mRNA linear PRI 02-JUN-2013 DEFINITION Homo sapiens POU class 5 homeobox 1B (POU5F1B), mRNA. ACCESSION NM_001159542 VERSION NM_001159542.1 GI:227430409 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1599) AUTHORS Dentelli,P., Barale,C., Togliatto,G., Trombetta,A., Olgasi,C., Gili,M., Riganti,C., Toppino,M. and Brizzi,M.F. TITLE A diabetic milieu promotes OCT4 and NANOG production in human visceral-derived adipose stem cells JOURNAL Diabetologia 56 (1), 173-184 (2013) PUBMED 23064289 REMARK GeneRIF: Data suggest that expression of Oct4 and NANOG (Nanog homeobox protein) is up-regulated in visceral adipose tissue stem cells in type 2 diabetes as compared to control; expression is also up-regulated in hyperglycemic conditions. REFERENCE 2 (bases 1 to 1599) AUTHORS Clark,S.L., Adkins,D.E., Aberg,K., Hettema,J.M., McClay,J.L., Souza,R.P. and van den Oord,E.J. TITLE Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D JOURNAL Psychol Med 42 (6), 1151-1162 (2012) PUBMED 22041458 REFERENCE 3 (bases 1 to 1599) AUTHORS White,K.L., Sellers,T.A., Fridley,B.L., Vierkant,R.A., Phelan,C.M., Tsai,Y.Y., Kalli,K.R., Berchuck,A., Iversen,E.S., Hartmann,L.C., Liebow,M., Armasu,S., Fredericksen,Z., Larson,M.C., Duggan,D., Couch,F.J., Schildkraut,J.M., Cunningham,J.M. and Goode,E.L. TITLE Variation at 8q24 and 9p24 and risk of epithelial ovarian cancer JOURNAL Twin Res Hum Genet 13 (1), 43-56 (2010) PUBMED 20158306 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 4 (bases 1 to 1599) AUTHORS Crowther-Swanepoel,D., Broderick,P., Di Bernardo,M.C., Dobbins,S.E., Torres,M., Mansouri,M., Ruiz-Ponte,C., Enjuanes,A., Rosenquist,R., Carracedo,A., Jurlander,J., Campo,E., Juliusson,G., Montserrat,E., Smedby,K.E., Dyer,M.J., Matutes,E., Dearden,C., Sunter,N.J., Hall,A.G., Mainou-Fowler,T., Jackson,G.H., Summerfield,G., Harris,R.J., Pettitt,A.R., Allsup,D.J., Bailey,J.R., Pratt,G., Pepper,C., Fegan,C., Parker,A., Oscier,D., Allan,J.M., Catovsky,D. and Houlston,R.S. TITLE Common variants at 2q37.3, 8q24.21, 15q21.3 and 16q24.1 influence chronic lymphocytic leukemia risk JOURNAL Nat. Genet. 42 (2), 132-136 (2010) PUBMED 20062064 REFERENCE 5 (bases 1 to 1599) AUTHORS Panagopoulos,I., Moller,E., Collin,A. and Mertens,F. TITLE The POU5F1P1 pseudogene encodes a putative protein similar to POU5F1 isoform 1 JOURNAL Oncol. Rep. 20 (5), 1029-1033 (2008) PUBMED 18949397 REMARK GeneRIF: that a putative POU5F1P1 protein is localized in the nucleus, acts as a transcriptional activator and regulates the expression in a similar way to the POU5F1 isoform 1 REFERENCE 6 (bases 1 to 1599) AUTHORS Firsova,N.V., Markintantova,Iu.V., Smirnova,Iu.A., Panova,I.G., Sukhikh,G.T., Zinov'eva,R.D. and Mitashov,V.I. TITLE [Identification of the OCT4-pg1 retrogene and NANOG gene expression in the human embryonic eye] JOURNAL Izv. Akad. Nauk. Ser. Biol. 2, 134-138 (2008) PUBMED 18946985 REFERENCE 7 (bases 1 to 1599) AUTHORS Yeager,M., Orr,N., Hayes,R.B., Jacobs,K.B., Kraft,P., Wacholder,S., Minichiello,M.J., Fearnhead,P., Yu,K., Chatterjee,N., Wang,Z., Welch,R., Staats,B.J., Calle,E.E., Feigelson,H.S., Thun,M.J., Rodriguez,C., Albanes,D., Virtamo,J., Weinstein,S., Schumacher,F.R., Giovannucci,E., Willett,W.C., Cancel-Tassin,G., Cussenot,O., Valeri,A., Andriole,G.L., Gelmann,E.P., Tucker,M., Gerhard,D.S., Fraumeni,J.F. Jr., Hoover,R., Hunter,D.J., Chanock,S.J. and Thomas,G. TITLE Genome-wide association study of prostate cancer identifies a second risk locus at 8q24 JOURNAL Nat. Genet. 39 (5), 645-649 (2007) PUBMED 17401363 REFERENCE 8 (bases 1 to 1599) AUTHORS Suo,G., Han,J., Wang,X., Zhang,J., Zhao,Y., Zhao,Y. and Dai,J. TITLE Oct4 pseudogenes are transcribed in cancers JOURNAL Biochem. Biophys. Res. Commun. 337 (4), 1047-1051 (2005) PUBMED 16229821 REFERENCE 9 (bases 1 to 1599) AUTHORS Marques,A.C., Dupanloup,I., Vinckenbosch,N., Reymond,A. and Kaessmann,H. TITLE Emergence of young human genes after a burst of retroposition in primates JOURNAL PLoS Biol. 3 (11), E357 (2005) PUBMED 16201836 REFERENCE 10 (bases 1 to 1599) AUTHORS Takeda,J., Seino,S. and Bell,G.I. TITLE Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues JOURNAL Nucleic Acids Res. 20 (17), 4613-4620 (1992) PUBMED 1408763 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DQ486513.1. Summary: This intronless gene was thought to be a transcribed pseudogene of POU class 5 homeobox 1, however, it has been reported that this gene can encode a functional protein. The encoded protein is nearly the same length as and highly similar to the POU class 5 homeobox 1 transcription factor, has been shown to be a weak transcriptional activator and may play a role in carcinogenesis and eye development. [provided by RefSeq, Apr 2009]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript is intronless :: DQ486513.1 [ECO:0000345] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1599 DQ486513.1 1-1599 FEATURES Location/Qualifiers source 1..1599 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="8" /map="8q24.21" gene 1..1599 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /note="POU class 5 homeobox 1B" /db_xref="GeneID:5462" /db_xref="HGNC:9223" exon 1..1599 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /inference="alignment:Splign:1.39.8" variation 21 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="t" /db_xref="dbSNP:3999777" variation 32 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="c" /db_xref="dbSNP:185974252" variation 41..43 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="" /replace="ata" /db_xref="dbSNP:112002137" variation 43..45 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="" /replace="aat" /db_xref="dbSNP:374993968" variation 166 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="t" /db_xref="dbSNP:190348884" variation 205 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:4871789" misc_feature 208..210 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /note="upstream in-frame stop codon" variation 232 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="g" /db_xref="dbSNP:75427380" CDS 256..1335 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /note="POU class 5 homeobox 1 pseudogene 1; POU domain, class 5, transcription factor 1 pseudogene 1; POU 5 domain protein; POU domain transcription factor Oct-4; POU domain transcription factor OCT4-pg1; octamer binding protein 3_like sequence" /codon_start=1 /product="putative POU domain, class 5, transcription factor 1B" /protein_id="NP_001153014.1" /db_xref="GI:227430410" /db_xref="CCDS:CCDS55274.1" /db_xref="GeneID:5462" /db_xref="HGNC:9223" /translation="
MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPGAVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFSQKTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLMQARKRKRTSIENRVRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN
" misc_feature 667..891 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /note="Found in Pit-Oct-Unc transcription factors; Region: POU; smart00352" /db_xref="CDD:197673" misc_feature 946..1119 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(946..960,964..966,1015..1017,1030..1032,1069..1071, 1075..1080,1087..1092,1096..1104,1108..1113) /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(952..954,961..963,1078..1080,1087..1092,1099..1101) /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" variation 303 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="t" /db_xref="dbSNP:1061391" variation 309 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:1061393" variation 353 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="g" /replace="t" /db_xref="dbSNP:1061394" variation 375 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="t" /db_xref="dbSNP:376562387" variation 397 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="g" /replace="t" /db_xref="dbSNP:76449652" variation 418 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="g" /replace="t" /db_xref="dbSNP:369395842" variation 441 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="t" /db_xref="dbSNP:3211306" variation 462 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="c" /db_xref="dbSNP:1061395" variation 555 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="t" /db_xref="dbSNP:77810828" variation 561 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="g" /replace="t" /db_xref="dbSNP:200266503" variation 604 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:190778660" variation 610 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="c" /db_xref="dbSNP:182632506" variation 725 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="g" /replace="t" /db_xref="dbSNP:188813106" variation 736 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:140000439" variation 782 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:6998061" variation 800 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="c" /db_xref="dbSNP:13273814" variation 865 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="t" /db_xref="dbSNP:192151034" variation 884 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="c" /db_xref="dbSNP:377535415" variation 895 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:13274084" variation 939 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:6998254" variation 967 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="g" /db_xref="dbSNP:7002225" variation 1055 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:182961302" variation 1194 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:374138216" variation 1217 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="g" /db_xref="dbSNP:371019833" variation 1258 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="t" /db_xref="dbSNP:148676795" variation 1270 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="g" /db_xref="dbSNP:142141895" STS 1341..1455 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /standard_name="POU5F1" /db_xref="UniSTS:479943" variation 1360 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:373454446" variation 1363 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="c" /db_xref="dbSNP:187298898" variation 1366 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="g" /db_xref="dbSNP:371237720" variation 1406 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="g" /db_xref="dbSNP:9297754" variation 1459 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="t" /db_xref="dbSNP:9297755" variation 1470 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:78931371" variation 1472 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="t" /db_xref="dbSNP:182512875" variation 1558 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="t" /db_xref="dbSNP:188074125" variation 1572 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="t" /db_xref="dbSNP:3179559" variation 1580 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="t" /db_xref="dbSNP:192359771" variation 1582..1583 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="" /replace="t" /db_xref="dbSNP:199935435" variation 1595 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:200889381" variation 1596 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="a" /replace="g" /db_xref="dbSNP:368932899" variation 1599 /gene="POU5F1B" /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8" /replace="c" /replace="t" /db_xref="dbSNP:74548710" ORIGIN
aacatttccaaatcttggcattcttatccacaaagtgaagataataattgtcaattcacaggtgattatgatttaaagagattacttttgaagagttcctaacacattcagtcaacatttaatgatgcttcaggcactgtgttcattgctagtgagcgtatgacacacacagccatacggtcacagagctttcaatgaaaagtaacataattgctcatttcaccaggcccccggcttggggcgccttccttccccatggcgggacacctggcttcggatttcgccttctcgccccctccaggcggtgggggtgatgggccatggggggcggagccgggctgggttgatcctctgacctggctaagcttccaaggccctcctggagggccaggaatcgggccgggggttgggccaggctctgaggtgtgggggattcccccttgccccccgccgtatgagttatgtggggggatggcgtactgtgggcctcaggttggagtggggctagtgccccaaggcggcttggagacctctcagcctgagagcgaagcaggagtcggggtggagagcaactccaatggggcctccccggaaccctgcaccgtcccccctggtgccgtgaagctggagaaggagaagctagagcaaaacccggagaagtcccaggacatcaaagctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctgggatatacacaggccgatgtggggctcatcctgggggttctatttgggaaggtgttcagccaaaagaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcatgcaggcccgaaagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagatcagccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtgtcctttcctccggccccagggccccattttggtaccccaggctatgggagccctcacttcactgcactgtactcctcagtccctttccctgagggggaagtctttcccccagtctccgtcatcactctgggctctcccatgcattcaaactgaggtgcctgcccttctaggaatggggaacaggggaggggaggagctagggaaagagaacctggagtttgtggcagggcttttgggattaagttcttcattcactaaggaaggaattgggaacactaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaatgatgctcttgattttaatcccacatcatgtatcacttttttcttaaataaagaagcctgggacacagtaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:5462 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: TAS GeneID:5462 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA GeneID:5462 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:5462 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: NAS GeneID:5462 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.