GGRNA Home | Help | Advanced search

2024-04-24 10:51:52, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001146191            4576 bp    mRNA    linear   PRI 14-MAY-2013
DEFINITION  Homo sapiens myelin protein zero-like 1 (MPZL1), transcript variant
            3, mRNA.
ACCESSION   NM_001146191
VERSION     NM_001146191.1  GI:226054870
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4576)
  AUTHORS   Cummings,A.C., Jiang,L., Velez Edwards,D.R., McCauley,J.L.,
            Laux,R., McFarland,L.L., Fuzzell,D., Knebusch,C., Caywood,L.,
            Reinhart-Mercer,L., Nations,L., Gilbert,J.R., Konidari,I.,
            Tramontana,M., Cuccaro,M.L., Scott,W.K., Pericak-Vance,M.A. and
            Haines,J.L.
  TITLE     Genome-wide association and linkage study in the Amish detects a
            novel candidate late-onset Alzheimer disease gene
  JOURNAL   Ann. Hum. Genet. 76 (5), 342-351 (2012)
   PUBMED   22881374
REFERENCE   2  (bases 1 to 4576)
  AUTHORS   Gallardo,E., Garcia,A., Ramon,C., Maravi,E., Infante,J., Gaston,I.,
            Alonso,A., Combarros,O., De Jonghe,P. and Berciano,J.
  TITLE     Charcot-Marie-Tooth disease type 2J with MPZ Thr124Met mutation:
            clinico-electrophysiological and MRI study of a family
  JOURNAL   J. Neurol. 256 (12), 2061-2071 (2009)
   PUBMED   19629567
  REMARK    GeneRIF: Clinico-electrophysiological features and MRI findings are
            described in leg musculature from three patients belonging to a
            CMT2J pedigree due to MPZ Thr124Met mutation.
REFERENCE   3  (bases 1 to 4576)
  AUTHORS   Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A.
  TITLE     Follow-up of a major linkage peak on chromosome 1 reveals
            suggestive QTLs associated with essential hypertension: GenNet
            study
  JOURNAL   Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009)
   PUBMED   19536175
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 4576)
  AUTHORS   Cheung,C.L., Chan,B.Y., Chan,V., Ikegawa,S., Kou,I., Ngai,H.,
            Smith,D., Luk,K.D., Huang,Q.Y., Mori,S., Sham,P.C. and Kung,A.W.
  TITLE     Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible
            genetic association with bone mineral density variation
  JOURNAL   Hum. Mol. Genet. 18 (4), 679-687 (2009)
   PUBMED   19064610
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 4576)
  AUTHORS   Kusano,K., Thomas,T.N. and Fujiwara,K.
  TITLE     Phosphorylation and localization of protein-zero related (PZR) in
            cultured endothelial cells
  JOURNAL   Endothelium 15 (3), 127-136 (2008)
   PUBMED   18568953
  REMARK    GeneRIF: Phosphorylation and localization of PZR in cultured
            endothelial cells is reported.
REFERENCE   6  (bases 1 to 4576)
  AUTHORS   Wistow,G., Bernstein,S.L., Wyatt,M.K., Fariss,R.N., Behal,A.,
            Touchman,J.W., Bouffard,G., Smith,D. and Peterson,K.
  TITLE     Expressed sequence tag analysis of human RPE/choroid for the
            NEIBank Project: over 6000 non-redundant transcripts, novel genes
            and splice variants
  JOURNAL   Mol. Vis. 8, 205-220 (2002)
   PUBMED   12107410
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 4576)
  AUTHORS   Zhao,R., Guerrah,A., Tang,H. and Zhao,Z.J.
  TITLE     Cell surface glycoprotein PZR is a major mediator of concanavalin
            A-induced cell signaling
  JOURNAL   J. Biol. Chem. 277 (10), 7882-7888 (2002)
   PUBMED   11751924
  REMARK    GeneRIF: PZR is a major receptor of ConA and has an important role
            in cell signaling via c-Src. Considering the various biological
            activities of ConA, the study of PZR may have major therapeutic
            implications
REFERENCE   8  (bases 1 to 4576)
  AUTHORS   Zhao,R. and Zhao,Z.J.
  TITLE     Dissecting the interaction of SHP-2 with PZR, an immunoglobulin
            family protein containing immunoreceptor tyrosine-based inhibitory
            motifs
  JOURNAL   J. Biol. Chem. 275 (8), 5453-5459 (2000)
   PUBMED   10681522
REFERENCE   9  (bases 1 to 4576)
  AUTHORS   Tang,D.S., Yu,K.P., Tang,X.X., Zhang,H.L., Pan,Q., Dai,H.P. and
            Xia,J.H.
  TITLE     Cloning of Human Myelin Protein Zero-like Genes by Bioinformatics
            Strategy
  JOURNAL   Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 32 (4), 364-368 (2000)
   PUBMED   12075424
REFERENCE   10 (bases 1 to 4576)
  AUTHORS   Zhao,Z.J. and Zhao,R.
  TITLE     Purification and cloning of PZR, a binding protein and putative
            physiological substrate of tyrosine phosphatase SHP-2
  JOURNAL   J. Biol. Chem. 273 (45), 29367-29372 (1998)
   PUBMED   9792637
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DA725074.1, AK297112.1, Z99943.1 and AW292498.1.
            
            Transcript Variant: This variant (3) lacks three alternate exons in
            the 3' coding region that results in a frameshift, compared to
            variant 1. The encoded isoform (c) is shorter than isoform a.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC000984.1, AK297112.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-29                DA725074.1         1-29
            30-1124             AK297112.1         1-1095
            1125-4269           Z99943.1           64781-67925
            4270-4576           AW292498.1         1-307               c
FEATURES             Location/Qualifiers
     source          1..4576
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q24.2"
     gene            1..4576
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="myelin protein zero-like 1"
                     /db_xref="GeneID:9019"
                     /db_xref="HGNC:7226"
                     /db_xref="MIM:604376"
     exon            1..293
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     CDS             203..562
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="isoform c precursor is encoded by transcript
                     variant 3; protein zero related; myelin protein zero-like
                     protein 1; immunoglobulin family transmembrane protein;
                     protein zero-related"
                     /codon_start=1
                     /product="myelin protein zero-like protein 1 isoform c
                     precursor"
                     /protein_id="NP_001139663.1"
                     /db_xref="GI:226054871"
                     /db_xref="CCDS:CCDS53425.1"
                     /db_xref="GeneID:9019"
                     /db_xref="HGNC:7226"
                     /db_xref="MIM:604376"
                     /translation="
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
"
     sig_peptide     203..313
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    317..>460
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:213125"
     variation       242
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113319606"
     variation       243
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368926182"
     exon            294..460
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       319
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200435022"
     variation       338
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369822857"
     variation       372
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375713174"
     variation       397
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150711804"
     variation       404
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146968580"
     variation       415
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143448673"
     variation       418
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201705663"
     variation       450
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369996563"
     exon            461..4560
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       483
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146099511"
     variation       493
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139028868"
     variation       497
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146869026"
     variation       514..515
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34626910"
     STS             524..680
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="SHGC-75878"
                     /db_xref="UniSTS:7599"
     variation       543
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375874838"
     variation       544
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200004895"
     variation       552
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190661858"
     variation       574
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377498586"
     variation       697
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141592237"
     variation       733
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150901710"
     variation       748
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78809449"
     variation       843
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182898542"
     variation       844
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185441444"
     variation       887
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190151302"
     variation       1012
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41270734"
     variation       1146
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182824572"
     STS             1173..1318
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="RH12295"
                     /db_xref="UniSTS:58576"
     variation       1250
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112509046"
     variation       1260
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187389510"
     variation       1355
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:193160724"
     variation       1361
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138177732"
     variation       1363
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183755663"
     variation       1422
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73037892"
     variation       1427
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:114584283"
     variation       1441
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115952869"
     variation       1464
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:72697779"
     variation       1472
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149549702"
     variation       1484
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370896138"
     variation       1493
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193135489"
     variation       1502
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147274411"
     variation       1521
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34678493"
     variation       1598
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140780938"
     variation       1666
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:720612"
     variation       1677
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113574305"
     variation       1707
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147412044"
     variation       1725
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:183563193"
     variation       1740..1741
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35089441"
     variation       1783
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12072200"
     variation       1830
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186815046"
     variation       1841
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7414295"
     variation       1911
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:191636295"
     variation       1924
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184020611"
     variation       1926
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:189800509"
     variation       1946
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182056523"
     variation       1959
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185413057"
     variation       2055
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:10125"
     variation       2067
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142735758"
     variation       2094
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114704696"
     variation       2097..2101
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="aagat"
                     /db_xref="dbSNP:66529257"
     variation       2113
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76940524"
     variation       2127
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35215126"
     STS             2142..2977
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="MPZL1__7200"
                     /db_xref="UniSTS:466339"
     variation       2188
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3752606"
     variation       2244
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151009335"
     variation       2286
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140712114"
     variation       2305
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3088322"
     variation       2400
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143124803"
     variation       2402
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12745388"
     variation       2537
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74388383"
     variation       2543
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146700702"
     STS             2567..2641
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="D1S1803E"
                     /db_xref="UniSTS:150719"
     STS             2656..2793
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="WI-12092"
                     /db_xref="UniSTS:34243"
     STS             2657..2756
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="D1S1795E"
                     /db_xref="UniSTS:47740"
     variation       2680
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190565454"
     variation       2685
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7605"
     STS             2767..3522
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="FLJ21047_2474"
                     /db_xref="UniSTS:463588"
     STS             2817..2918
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="RH36145"
                     /db_xref="UniSTS:64757"
     variation       2823
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11807657"
     variation       2924
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181999887"
     variation       2977
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:14212"
     variation       3008..3011
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="agtt"
                     /db_xref="dbSNP:374021239"
     variation       3055
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61995896"
     variation       3142
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140274317"
     variation       3155
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8917"
     variation       3242
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:8623"
     variation       3256
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185284937"
     STS             3266..3379
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="A007A43"
                     /db_xref="UniSTS:35948"
     variation       3298
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145325991"
     variation       3306
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12316"
     variation       3569
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12071420"
     variation       3593
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189891170"
     variation       3600
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148979779"
     variation       3713
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113581119"
     variation       3802
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148155475"
     variation       3829
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141847648"
     variation       3874
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368920044"
     variation       3926
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:10753763"
     variation       3973
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:76775177"
     variation       4010
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371184482"
     variation       4039
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35065671"
     variation       4095
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:139012766"
     variation       4125
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181105938"
     variation       4135
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:10753764"
     variation       4151
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186660095"
     variation       4204
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191445959"
     variation       4210
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183602418"
     variation       4211
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:10800323"
     variation       4292
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188493549"
     variation       4377
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143146901"
     variation       4474
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192283907"
     variation       4557
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147481157"
ORIGIN      
agcgagggccggagtggggctgaggcttcggtgcagagctggagagccgcggctgggaccggagtggggagcgcggcgtggaggtgccacccggcgcgggtggcggagagatcagaagcctcttccccaagccgagccaacctcagcggggacccgggctcagggacgcggcggcggcggcggcgactgcagtggctggacgatggcagcgtccgccggagccggggcggtgattgcagccccagacagccggcgctggctgtggtcggtgctggcggcggcgcttgggctcttgacagctggagtatcagccttggaagtatatacgccaaaagaaatcttcgtggcaaatggtacacaagggaagctgacctgcaagttcaagtctactagtacgactggcgggttgacctcagtctcctggagcttccagccagagggggccgacactactgtgtcgggcccagtcatatatgcacagttagaccactccggcggacatcacagtgacaagattaacaagtcagagtctgtggtgtatgcggatatccgaaagaattaagagaatacctagaacatatcctcagcaagaaacaaaaccaaactggactctcgtgcagaaaatgtagcccattaccacatgtagccttggagacccaggcaaggacaagtacacgtgtactcacagagggagagaaagatgtgtacaaaggatatgtataaatattctatttagtcatcctgatatgaggagccagtgttgcatgatgaaaagatggtatgattctacatatgtacccattgtcttgctgtttttgtactttcttttcaggtcatttacaattgggagatttcagaaacattcctttcaccatcatttagaaatggtttgccttaatggagacaatagcagatcctgtagtatttccagtagacatggccttttaatctaagggcttaagactgattagtcttagcatttactgtagttggaggatggagatgctatgatggaagcatacccagggtggcctttagcacagtatcagtaccatttatttgtctgccgcttttaaaaaatacccattggctatgccacttgaaaacaatttgagaagtttttttgaagtttttctcactaaaatatggggcaattgttagccttacatgttgtgtagacttactttaagtttgcacccttgaaatgtgtcatatcaatttctggattcataatagcaagattagcaaaggataaatgccgaaggtcacttcattctggacacagttggatcaatactgattaagtagaaaatccaagctttgcttgagaacttttgtaacgtggagagtaaaaagtatcggttttattctttgctgatgtcctttctgcttgaaataacagtcaccatacagctaaaggagaggagtttctttccttctaagtaggcagaaatggtatcattatgttgccgctctccaatctcccagagctcgctctctagagaatcaccttctttcgcttttttttttttttttgaggtagagtctcactatgttgcccagactagccttgaactcttgggctcaagtgattctccctcctcagcctcccgagtagctggaacgaactatagttgcaccactgcagctggcaagaatcaccttctttataaagcgtcagtcatgcttccagcaagaggcagcatcagtcatggctttataacagcttcatggtgcctcaaagactgttgaggttaatgagagcctagattagacagtttggctgtccttccctaaaacttgttttctcctattcactactccccaccgcacttaaaatctatgagtttttactttttactgggaatggaaagtgtggtgaagatcattcaacacttatgttgtcatttctcccattttctgaatttttttttaaatttccccccttttaaaattgttcgaaagcccacagttatggaaagaattactgtctagatggtctgcagaacgtgtttggggtgagtgggagtgaggggcaatgttactttttctccctgtagtttggagtccattatgagctgctgctttttcttctcatcttgtcatcttctggggatgtttgaaggctgagttccaacagaattcacaaagggaataaaacaggattgagattttgaggtgtgcacaaggtggtaagataaagggcatatgagcttcaaaactaatgctgttgcatacatgaagccttttgttttttgaggagctatttttgttattcttgtaacgctccaccttacatgccacatctgtgtgagtcaacagggatcaggtttggtcaccacacatgtctgaagctgggcagcgtctgctctgtgttctgtgtggaatggagaaaaaaacgcctgccctgctgccttccatgttcataggcccagcccaagagagtgacacacagtgctggccctgagacatttccacaaagtggtcaactctgccttgcatcctaaaactttttgggcatctattttgaaaactataggagcctttggaaggcctcttatgtttggaggggaagggtgttgagattgtcaccatccttcaagctgagactcctggtgagcctttgccaccatgaaaaccacatagctgaccagggctgtgcttgaggtacagaggacacacattgtagacaggcctgtgtcatgtttccttacagtcgttttttacagagaaaaggggcattgttttttcactgctttctcaacagttcctgtgaataaatgaaacatttcggagctccctgagagcaagagccttcacttcttcttgcggtgccgggaccatgtgttggtgaagctggtgctgtgggggccactcactcgaatgacacctggaggcctgttcctcccttaccactcccttccccagcccgacttcttggcctcctgcccaaccagacacctcaaactctgtcagtgccctggcattctggcagagaatcctcaccagttctcaccaaccttccccccaggcaagggcagctgccagcatggtgctctgccaggacaggtttccctgaaggaagctgctcacactgagatgagcctctcagggcaggacctcttcccaagccctgcacacccacccctgcagcccttttggctccccttttccctgtgcctcagcactcctttcctggttgcagataacgaactaaggttgcctaaagggcagatctgccctctccatgtcttcgtcctggcaaacagggtcgtcttaaaattatgcgctaattctgtatgggagcactcaaaaggcattacttagagattgaaatttcaaactatctctagtttttcaatggaaatatatcagctagggaaaaaccatcaagctcattattattttttgatcttcagttgtatttttgtgaatattttaatacatctttttcaatttctgaattgtgttgtgtgctcattttgaccagaatagaaaaagagatatgcctttcactcatatcattccagctacacctgccttcttttcttcaaaaatgccgtccgtgtgcctgcttctgggcctttgcacatgctgttccctgggcctgaagcatgccttctgccaatattcctgtggtttgctctctgacttcctttaagcctctgctcaaatgttacctcctcagggagaccttctgtgatatataaaagagcaagccccccaccccaccgcctcagccttcctggccccctcagttctgctctagttactctatttctctccctctttcccagtacacacttgtctgttctcccgcattagaacatagttaacaagagaccagaaccttgctgttttgttcactgctccgtctgcagtaaagggaacagcacctggcacttagctgctcaatacatgttacgtggatggatgagtaggtggaagcattcatccattcagcaacctacactgagaacaatcctgtgccaagcactgtgctaagcataaggaaacaaaacaagacaaagctcctcaaggagcttgccacagggtggaggtgacaggtgacatgaatggaagtaactagtagttaccaaatacttggtgtgagccaggcactttgcatttctttctctattatttctgtgagttaacagtaattgtactaatcttaatcccattgtttgaaagattatatggcttacccagggccacttagctaataaaggaacagagaagaggggctgggcctggggccgctgtttgatccacagccttgttcctaaccactatgccctgtggcctctcacaccaaaaggaagtaccaaactgcttccttactcaaataaatgtgctgaaatgcagttgcagttttctcccagtcccttaggagctggttagagagtcccttaggaacttgagagggtagtgtagtctaggtggtaggcacagatgtctgagagctttaacctcagtctggaagacaatgtggtgacttaatttgttgagaactatgttacaaataatgtgttactaataaaacattgaggcttcgcaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:9019 -> Molecular function: GO:0005198 [structural molecule activity] evidence: TAS
            GeneID:9019 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:9019 -> Biological process: GO:0007169 [transmembrane receptor protein tyrosine kinase signaling pathway] evidence: TAS
            GeneID:9019 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
            GeneID:9019 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.