GGRNA Home | Help | Advanced search

2019-03-23 03:25:54, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001146095            2748 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens FANCD2/FANCI-associated nuclease 1 (FAN1), transcript
            variant 3, mRNA.
ACCESSION   NM_001146095
VERSION     NM_001146095.1  GI:226246526
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2748)
  AUTHORS   Zhou,W., Otto,E.A., Cluckey,A., Airik,R., Hurd,T.W., Chaki,M.,
            Diaz,K., Lach,F.P., Bennett,G.R., Gee,H.Y., Ghosh,A.K.,
            Natarajan,S., Thongthip,S., Veturi,U., Allen,S.J., Janssen,S.,
            Ramaswami,G., Dixon,J., Burkhalter,F., Spoendlin,M., Moch,H.,
            Mihatsch,M.J., Verine,J., Reade,R., Soliman,H., Godin,M., Kiss,D.,
            Monga,G., Mazzucco,G., Amann,K., Artunc,F., Newland,R.C., Wiech,T.,
            Zschiedrich,S., Huber,T.B., Friedl,A., Slaats,G.G., Joles,J.A.,
            Goldschmeding,R., Washburn,J., Giles,R.H., Levy,S., Smogorzewska,A.
            and Hildebrandt,F.
  TITLE     FAN1 mutations cause karyomegalic interstitial nephritis, linking
            chronic kidney failure to defective DNA damage repair
  JOURNAL   Nat. Genet. 44 (8), 910-915 (2012)
   PUBMED   22772369
  REMARK    GeneRIF: By exome sequencing, we identified mutations in FAN1 as a
            cause of karyomegalic interstitial nephritis, a disorder that
            serves as a model for renal fibrosis.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2748)
  AUTHORS   Trujillo,J.P., Mina,L.B., Pujol,R., Bogliolo,M., Andrieux,J.,
            Holder,M., Schuster,B., Schindler,D. and Surralles,J.
  TITLE     On the role of FAN1 in Fanconi anemia
  JOURNAL   Blood 120 (1), 86-89 (2012)
   PUBMED   22611161
  REMARK    GeneRIF: Our results suggest that FAN1 has a minor role in
            interstrand crosslink repair compared with true Fanconi anemia
            genes and exclude FAN1 as a novel FA gene.
REFERENCE   3  (bases 1 to 2748)
  AUTHORS   Park,D.J., Odefrey,F.A., Hammet,F., Giles,G.G., Baglietto,L.,
            ABCFS, MCCS, Hopper,J.L., Schmidt,D.F., Makalic,E.,
            Sinilnikova,O.M., Goldgar,D.E. and Southey,M.C.
  TITLE     FAN1 variants identified in multiple-case early-onset breast cancer
            families via exome sequencing: no evidence for association with
            risk for breast cancer
  JOURNAL   Breast Cancer Res. Treat. 130 (3), 1043-1049 (2011)
   PUBMED   21858661
  REMARK    GeneRIF: Two FAN1 variants do not appear to be causal for breast
            cancer.
REFERENCE   4  (bases 1 to 2748)
  AUTHORS   Yoshikiyo,K., Kratz,K., Hirota,K., Nishihara,K., Takata,M.,
            Kurumizaka,H., Horimoto,S., Takeda,S. and Jiricny,J.
  TITLE     KIAA1018/FAN1 nuclease protects cells against genomic instability
            induced by interstrand cross-linking agents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 107 (50), 21553-21557 (2010)
   PUBMED   21115814
  REMARK    GeneRIF: Data show that FAN1 in DT40 cells participates in the
            processing of damage induced by interstrand
            cross-linking-generating agents also independently of the classical
            FA pathway.
REFERENCE   5  (bases 1 to 2748)
  AUTHORS   Shereda,R.D., Machida,Y. and Machida,Y.J.
  TITLE     Human KIAA1018/FAN1 localizes to stalled replication forks via its
            ubiquitin-binding domain
  JOURNAL   Cell Cycle 9 (19), 3977-3983 (2010)
   PUBMED   20935496
  REMARK    GeneRIF: Data show that FAN1 is a nuclear protein and forms
            DNA-damage-induced foci, which appear to be at stalled replication
            forks as denoted by RPA colocalization.
REFERENCE   6  (bases 1 to 2748)
  AUTHORS   Liu,T., Ghosal,G., Yuan,J., Chen,J. and Huang,J.
  TITLE     FAN1 acts with FANCI-FANCD2 to promote DNA interstrand cross-link
            repair
  JOURNAL   Science 329 (5992), 693-696 (2010)
   PUBMED   20671156
  REMARK    GeneRIF: study characterizes FANI which promotes DNA interstrand
            cross-linking repair in a manner strictly dependent on its ability
            to accumulate at or near sites of DNA damage and that relies on
            mono-ubiquitylation of the FANCI-FANCD2 complex
REFERENCE   7  (bases 1 to 2748)
  AUTHORS   Smogorzewska,A., Desetty,R., Saito,T.T., Schlabach,M., Lach,F.P.,
            Sowa,M.E., Clark,A.B., Kunkel,T.A., Harper,J.W., Colaiacovo,M.P.
            and Elledge,S.J.
  TITLE     A genetic screen identifies FAN1, a Fanconi anemia-associated
            nuclease necessary for DNA interstrand crosslink repair
  JOURNAL   Mol. Cell 39 (1), 36-47 (2010)
   PUBMED   20603073
  REMARK    GeneRIF: FAN1 colocalizes at sites of DNA damage with the ID
            complex in a manner dependent on FAN1's ubiquitin-binding domain
            (UBZ), the FANCI-FAND2 (ID) complex, and monoubiquitination of
            FANCD2.
REFERENCE   8  (bases 1 to 2748)
  AUTHORS   Kratz,K., Schopf,B., Kaden,S., Sendoel,A., Eberhard,R.,
            Lademann,C., Cannavo,E., Sartori,A.A., Hengartner,M.O. and
            Jiricny,J.
  TITLE     Deficiency of FANCD2-associated nuclease KIAA1018/FAN1 sensitizes
            cells to interstrand crosslinking agents
  JOURNAL   Cell 142 (1), 77-88 (2010)
   PUBMED   20603016
  REMARK    GeneRIF: KIAA1018 is a 5'-->3' exonuclease and a structure-specific
            endonuclease that preferentially incises 5' flaps; like cells from
            FA patients, human cells depleted of KIAA1018 are sensitized to
            ICL-inducing agents and display chromosomal instability.
REFERENCE   9  (bases 1 to 2748)
  AUTHORS   MacKay,C., Declais,A.C., Lundin,C., Agostinho,A., Deans,A.J.,
            MacArtney,T.J., Hofmann,K., Gartner,A., West,S.C., Helleday,T.,
            Lilley,D.M. and Rouse,J.
  TITLE     Identification of KIAA1018/FAN1, a DNA repair nuclease recruited to
            DNA damage by monoubiquitinated FANCD2
  JOURNAL   Cell 142 (1), 65-76 (2010)
   PUBMED   20603015
  REMARK    GeneRIF: Study describes how a highly conserved protein,
            KIAA1018/MTMR15/FAN1, that interacts with, and is recruited to
            sites of DNA damage by, the monoubiquitinated form of FANCD2.
REFERENCE   10 (bases 1 to 2748)
  AUTHORS   Alonso,A., Sasin,J., Bottini,N., Friedberg,I., Friedberg,I.,
            Osterman,A., Godzik,A., Hunter,T., Dixon,J. and Mustelin,T.
  TITLE     Protein tyrosine phosphatases in the human genome
  JOURNAL   Cell 117 (6), 699-711 (2004)
   PUBMED   15186772
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC047882.1 and BC044890.1.
            
            Summary: This gene encodes a member of the myotubularin-related
            class 1 cysteine-based protein tyrosine phosphatases. The encoded
            protein may be catalytically inactive. Alternatively spliced
            transcript variants have been described. [provided by RefSeq, Apr
            2009].
            
            Transcript Variant: This variant (3) differs in the 5' UTR, 3' UTR,
            and 3' coding region, compared to variant 1. The resulting isoform
            (b) has a distinct C-terminus and is shorter than isoform a.
            Variants 2, 3 and 4 encode the same isoform (b).
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC047882.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-215               BC047882.1         1-215
            216-2215            BC044890.1         176-2175
            2216-2216           BC047882.1         2219-2219
            2217-2748           BC044890.1         2177-2708
FEATURES             Location/Qualifiers
     source          1..2748
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q13.2-q13.3"
     gene            1..2748
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /note="FANCD2/FANCI-associated nuclease 1"
                     /db_xref="GeneID:22909"
                     /db_xref="HGNC:29170"
                     /db_xref="MIM:613534"
     exon            1..36
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /inference="alignment:Splign:1.39.8"
     exon            37..1422
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /inference="alignment:Splign:1.39.8"
     variation       103
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113045164"
     misc_feature    117..119
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /note="upstream in-frame stop codon"
     variation       167
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369326801"
     CDS             189..1790
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /EC_number="3.1.4.1"
                     /note="isoform b is encoded by transcript variant 3;
                     fanconi anemia associated nuclease 1; coiled-coil
                     domain-containing protein MTMR15; myotubularin-related
                     protein 15"
                     /codon_start=1
                     /product="fanconi-associated nuclease 1 isoform b"
                     /protein_id="NP_001139567.1"
                     /db_xref="GI:226246527"
                     /db_xref="CCDS:CCDS58344.1"
                     /db_xref="GeneID:22909"
                     /db_xref="HGNC:29170"
                     /db_xref="MIM:613534"
                     /translation="
MMSEGKPPDKKRPRRSLSISKNKKKASNSIISCFNNAPPAKLACPVCSKMVPRYDLNRHLDEMCANNDFVQVDPGQVGLINSNVSMVDLTSVTLEDVTPKKSPPPKTNLTPGQSDSAKREVKQKISPYFKSNDVVCKNQDELRNRSVKVICLGSLASKLSRKYVKAKKSIDKDEEFAGSSPQSSKSTVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRGSKIMEAESQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACHCEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQGSSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVRLFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSLAKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRFCWLLLQ
"
     misc_feature    228..254
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y2M0.4);
                     Region: D-box"
     misc_feature    309..374
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /note="Rad18-like CCHC zinc finger; Region: ZnF_Rad18;
                     smart00734"
                     /db_xref="CDD:128973"
     misc_feature    822..830
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y2M0.4);
                     Region: KEN box"
     variation       189
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139312614"
     variation       193
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143294144"
     variation       198
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369398471"
     variation       201
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149291568"
     variation       268
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139353520"
     variation       274
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199574217"
     variation       295
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146249441"
     variation       303
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183652083"
     variation       317
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200233447"
     variation       324
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371593413"
     variation       329
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144469584"
     variation       337
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148404807"
     variation       349
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376214743"
     variation       362
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143965941"
     variation       387
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146522953"
     variation       406
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201860403"
     variation       413
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376882561"
     variation       416
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367612076"
     variation       444
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139988104"
     variation       477
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375827355"
     variation       480
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199838412"
     variation       496
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200672666"
     variation       514
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76725957"
     variation       517
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151206988"
     variation       518
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139159448"
     variation       588
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144046046"
     variation       617
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:199537330"
     variation       622
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146408181"
     variation       630
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113751993"
     variation       649
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145226318"
     variation       678
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142350646"
     variation       685
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146422014"
     variation       695
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372161455"
     variation       699
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376003074"
     variation       704
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139019089"
     variation       719
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201499851"
     variation       721
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367894669"
     variation       745
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148610242"
     variation       753
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377089680"
     variation       761
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201722958"
     variation       778
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376369585"
     variation       786
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369093658"
     variation       791
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142084532"
     variation       796
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373390525"
     variation       839
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:374878731"
     variation       843
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143816528"
     variation       844
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:189713653"
     variation       854
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376528017"
     variation       860
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369869010"
     variation       873
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148140498"
     variation       886
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4779794"
     variation       889
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17846417"
     variation       906
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150748572"
     variation       919
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200798913"
     variation       959
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372989498"
     variation       970
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:137920161"
     variation       971
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142437586"
     variation       995
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199810253"
     variation       1024
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376256721"
     variation       1075
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145950723"
     variation       1117
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201220536"
     variation       1129
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139809129"
     variation       1132
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143534852"
     variation       1149
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144577204"
     variation       1278
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187082481"
     variation       1281
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370459391"
     variation       1298
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114136100"
     variation       1299
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142597944"
     variation       1317
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151322829"
     variation       1331
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142470367"
     variation       1349
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:192293773"
     variation       1365
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115139636"
     variation       1366
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140632948"
     variation       1372
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201153099"
     variation       1382
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141494062"
     variation       1390
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150484853"
     exon            1423..1563
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /inference="alignment:Splign:1.39.8"
     variation       1435
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200759965"
     variation       1452
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:374895181"
     variation       1458
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368417113"
     variation       1459
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138307818"
     variation       1470
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372815502"
     variation       1498
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79759675"
     variation       1513
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75820658"
     variation       1521
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200504684"
     variation       1538
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138954416"
     variation       1540
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:182455628"
     variation       1541
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142501642"
     exon            1564..2738
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /inference="alignment:Splign:1.39.8"
     variation       1587
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377131039"
     variation       1682
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199855919"
     variation       1708
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150393409"
     variation       1723
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370973001"
     variation       1740
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376174791"
     variation       1775
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79802476"
     variation       1778
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375485617"
     variation       1785
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369935463"
     variation       1786
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373034831"
     variation       1840
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3794594"
     variation       1892
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7183847"
     variation       1903..1904
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:374352331"
     variation       1955
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191452532"
     variation       2014
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3794595"
     variation       2165
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75007462"
     variation       2180
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183617582"
     variation       2241
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138151213"
     variation       2326
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61439612"
     STS             2430..2531
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /standard_name="WI-11934"
                     /db_xref="UniSTS:34421"
     variation       2502..2503
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:71838137"
     variation       2520..2521
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34387091"
     variation       2533
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1056118"
     variation       2550
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140369113"
     polyA_signal    2558..2563
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
     variation       2574
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111731930"
     variation       2681
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112451378"
     polyA_signal    2712..2717
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
     polyA_site      2738
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
ORIGIN      
ctgggaatgcctggaagcgccggcgcgcggagccaggaagaagaaattgtcgagacgaataacatgaggtcatatagaatcccacttttggtgatttcaagtcaagaaagtaaaagtaaaccattgctatctttcaccttaaatatcctgtgttttattgctcagaacatccagtttttctaatactcatgatgtcagaagggaaacctcctgacaaaaaaaggcctcgtagaagcttatcaatcagcaagaataagaaaaaagcatctaattctattatttcgtgttttaacaatgcaccacctgctaaacttgcctgccccgtttgcagtaaaatggtgcctagatatgacttaaaccggcaccttgatgaaatgtgtgctaacaatgacttcgttcaagtggatccagggcaggttggcttaataaattcaaatgtgtctatggtagatttaaccagtgttaccttagaagatgtaacacctaagaagtcaccaccaccaaagacaaatttaacccctggccaaagtgattcagcaaaaagggaagtaaagcagaagatcagtccctactttaaaagtaatgatgtggtgtgcaaaaatcaagatgagctgagaaatcgtagtgtgaaagtcatttgtttgggaagcctagcatctaaattgtccagaaaatacgtaaaggctaaaaaatcaatagataaggatgaagaatttgccggttctagtccacagagttccaaatccacagttgttaagagcctgattgataactcttcagaaattgaggacgaggatcaaattttggagaacagttctcaaaaagaaaacgtgtttaaatgtgattctctaaaggaagagtgcattcctgaacatatggtaagaggaagtaaaataatggaagccgaaagccaaaaggctacccgggaatgtgagaaatcagccctcacccctggattctcagataatgcgatcatgttattctcaccagatttcactcttaggaatacattaaagtctacttcagaagacagtcttgtaaagcaagagtgtatcaaagaagtggttgaaaaacgtgaggcatgtcattgtgaagaagtaaaaatgactgttgcttcagaagctaaaatacagctgtcagattcagaggcaaaatctcatagttctgcagatgatgcttctgcatggagtaacatccaagaggctcctctgcaggatgacagttgcttaaacaatgatatccctcacagcattcctttggagcaggggtcaagctgcaatggtcctggtcaaacaaccggtcatccttactaccttcggagtttccttgtggtgctgaaaaccgtacttgagaatgaagatgatatgttgctctttgatgagcaggagaagggaattgtaactaaattttatcagttatcagctactggtcagaagttatatgtaaggctctttcaacgtaaattaagctggattaagatgaccaaattagagtatgaagagattgccttagacttaacacctgtgattgaagaattgacgaatgcaggctttctacagacagaatctgagttgcaagaactctctgaagtgcttgaactcctttctgctcctgaactaaaatccctagccaagaccttccacttggtgaatcccaatggacagaaacagcagctggtggacgcctttctcaaattggccaaacagcgttcagtctgcacttggggcaagaataagcctggaattggtgcagtgattttaaaaaggttttgttggctattgttacagtaaaaacatttaaaatgttgatagcacatattaacttacagtagattgtatacttgattgaactgtaattgtttatttcagttgtagttagattgagaaggctggaaaagccttaattgcaatagcctggattctttcttgggttattattcaaaatttttgtcgtaataccgtactaatttccaggaccaagaaaaatcggaaggcaataggcctttggtaaattgtagtattttattttccgagaaaaatacagttttaagtgattcttatgggattttaaggtaaactatttagtcaaatttttattttagtttttgtttactaaacaaagtataatcaggcagtcttaatgtgcaagttttcctgagtttaaacgtaacaatttaccaaaaactgtgagtggcttcttttgtccttgagaagcccttgacctgtttcagttgaaaattacaaaaacttttagaattgatttcttttgcccatgttatttatataatcaaactatatcaactctagcctgggaattcactactgtggagtcgaggatgaaatgagaggatgcttttgaaaacactttaacatgatgttgttatttattttatatatttgttttgtatatttcagttgttatgagcccatccttgttggggaggtgctataaatactaatctttaatgaaacataggtgtaataaggcagacattaagaaaaatataaataccaacacttgaaaaaagctcgtgttatagatttttaaaaagtacttcaataaattacatacttgtaattaattgacttgagaagtatagaatcctcatctgtgtggtatgttaaatgtcttctaagtcctttctttatctaattgtatttcttaagtatttgatgttaaccttatatgtaacattttataagcaagtaaacattaaatttagccaccctctggctgggaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:22909 -> Molecular function: GO:0000287 [magnesium ion binding] evidence: TAS
            GeneID:22909 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
            GeneID:22909 -> Molecular function: GO:0004528 [phosphodiesterase I activity] evidence: IEA
            GeneID:22909 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:22909 -> Molecular function: GO:0008409 [5'-3' exonuclease activity] evidence: IDA
            GeneID:22909 -> Molecular function: GO:0017108 [5'-flap endonuclease activity] evidence: IDA
            GeneID:22909 -> Molecular function: GO:0043130 [ubiquitin binding] evidence: IDA
            GeneID:22909 -> Biological process: GO:0000724 [double-strand break repair via homologous recombination] evidence: IMP
            GeneID:22909 -> Biological process: GO:0006281 [DNA repair] evidence: IMP
            GeneID:22909 -> Biological process: GO:0006289 [nucleotide-excision repair] evidence: IMP
            GeneID:22909 -> Biological process: GO:0033683 [nucleotide-excision repair, DNA incision] evidence: IDA
            GeneID:22909 -> Biological process: GO:0033683 [nucleotide-excision repair, DNA incision] evidence: IMP
            GeneID:22909 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_001139567 -> EC 3.1.4.1

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.