GGRNA Home | Help | Advanced search

2019-03-24 19:52:27, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001146094            2851 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens FANCD2/FANCI-associated nuclease 1 (FAN1), transcript
            variant 2, mRNA.
ACCESSION   NM_001146094
VERSION     NM_001146094.1  GI:226246524
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2851)
  AUTHORS   Zhou,W., Otto,E.A., Cluckey,A., Airik,R., Hurd,T.W., Chaki,M.,
            Diaz,K., Lach,F.P., Bennett,G.R., Gee,H.Y., Ghosh,A.K.,
            Natarajan,S., Thongthip,S., Veturi,U., Allen,S.J., Janssen,S.,
            Ramaswami,G., Dixon,J., Burkhalter,F., Spoendlin,M., Moch,H.,
            Mihatsch,M.J., Verine,J., Reade,R., Soliman,H., Godin,M., Kiss,D.,
            Monga,G., Mazzucco,G., Amann,K., Artunc,F., Newland,R.C., Wiech,T.,
            Zschiedrich,S., Huber,T.B., Friedl,A., Slaats,G.G., Joles,J.A.,
            Goldschmeding,R., Washburn,J., Giles,R.H., Levy,S., Smogorzewska,A.
            and Hildebrandt,F.
  TITLE     FAN1 mutations cause karyomegalic interstitial nephritis, linking
            chronic kidney failure to defective DNA damage repair
  JOURNAL   Nat. Genet. 44 (8), 910-915 (2012)
   PUBMED   22772369
  REMARK    GeneRIF: By exome sequencing, we identified mutations in FAN1 as a
            cause of karyomegalic interstitial nephritis, a disorder that
            serves as a model for renal fibrosis.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2851)
  AUTHORS   Trujillo,J.P., Mina,L.B., Pujol,R., Bogliolo,M., Andrieux,J.,
            Holder,M., Schuster,B., Schindler,D. and Surralles,J.
  TITLE     On the role of FAN1 in Fanconi anemia
  JOURNAL   Blood 120 (1), 86-89 (2012)
   PUBMED   22611161
  REMARK    GeneRIF: Our results suggest that FAN1 has a minor role in
            interstrand crosslink repair compared with true Fanconi anemia
            genes and exclude FAN1 as a novel FA gene.
REFERENCE   3  (bases 1 to 2851)
  AUTHORS   Park,D.J., Odefrey,F.A., Hammet,F., Giles,G.G., Baglietto,L.,
            ABCFS, MCCS, Hopper,J.L., Schmidt,D.F., Makalic,E.,
            Sinilnikova,O.M., Goldgar,D.E. and Southey,M.C.
  TITLE     FAN1 variants identified in multiple-case early-onset breast cancer
            families via exome sequencing: no evidence for association with
            risk for breast cancer
  JOURNAL   Breast Cancer Res. Treat. 130 (3), 1043-1049 (2011)
   PUBMED   21858661
  REMARK    GeneRIF: Two FAN1 variants do not appear to be causal for breast
            cancer.
REFERENCE   4  (bases 1 to 2851)
  AUTHORS   Yoshikiyo,K., Kratz,K., Hirota,K., Nishihara,K., Takata,M.,
            Kurumizaka,H., Horimoto,S., Takeda,S. and Jiricny,J.
  TITLE     KIAA1018/FAN1 nuclease protects cells against genomic instability
            induced by interstrand cross-linking agents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 107 (50), 21553-21557 (2010)
   PUBMED   21115814
  REMARK    GeneRIF: Data show that FAN1 in DT40 cells participates in the
            processing of damage induced by interstrand
            cross-linking-generating agents also independently of the classical
            FA pathway.
REFERENCE   5  (bases 1 to 2851)
  AUTHORS   Shereda,R.D., Machida,Y. and Machida,Y.J.
  TITLE     Human KIAA1018/FAN1 localizes to stalled replication forks via its
            ubiquitin-binding domain
  JOURNAL   Cell Cycle 9 (19), 3977-3983 (2010)
   PUBMED   20935496
  REMARK    GeneRIF: Data show that FAN1 is a nuclear protein and forms
            DNA-damage-induced foci, which appear to be at stalled replication
            forks as denoted by RPA colocalization.
REFERENCE   6  (bases 1 to 2851)
  AUTHORS   Liu,T., Ghosal,G., Yuan,J., Chen,J. and Huang,J.
  TITLE     FAN1 acts with FANCI-FANCD2 to promote DNA interstrand cross-link
            repair
  JOURNAL   Science 329 (5992), 693-696 (2010)
   PUBMED   20671156
  REMARK    GeneRIF: study characterizes FANI which promotes DNA interstrand
            cross-linking repair in a manner strictly dependent on its ability
            to accumulate at or near sites of DNA damage and that relies on
            mono-ubiquitylation of the FANCI-FANCD2 complex
REFERENCE   7  (bases 1 to 2851)
  AUTHORS   Smogorzewska,A., Desetty,R., Saito,T.T., Schlabach,M., Lach,F.P.,
            Sowa,M.E., Clark,A.B., Kunkel,T.A., Harper,J.W., Colaiacovo,M.P.
            and Elledge,S.J.
  TITLE     A genetic screen identifies FAN1, a Fanconi anemia-associated
            nuclease necessary for DNA interstrand crosslink repair
  JOURNAL   Mol. Cell 39 (1), 36-47 (2010)
   PUBMED   20603073
  REMARK    GeneRIF: FAN1 colocalizes at sites of DNA damage with the ID
            complex in a manner dependent on FAN1's ubiquitin-binding domain
            (UBZ), the FANCI-FAND2 (ID) complex, and monoubiquitination of
            FANCD2.
REFERENCE   8  (bases 1 to 2851)
  AUTHORS   Kratz,K., Schopf,B., Kaden,S., Sendoel,A., Eberhard,R.,
            Lademann,C., Cannavo,E., Sartori,A.A., Hengartner,M.O. and
            Jiricny,J.
  TITLE     Deficiency of FANCD2-associated nuclease KIAA1018/FAN1 sensitizes
            cells to interstrand crosslinking agents
  JOURNAL   Cell 142 (1), 77-88 (2010)
   PUBMED   20603016
  REMARK    GeneRIF: KIAA1018 is a 5'-->3' exonuclease and a structure-specific
            endonuclease that preferentially incises 5' flaps; like cells from
            FA patients, human cells depleted of KIAA1018 are sensitized to
            ICL-inducing agents and display chromosomal instability.
REFERENCE   9  (bases 1 to 2851)
  AUTHORS   MacKay,C., Declais,A.C., Lundin,C., Agostinho,A., Deans,A.J.,
            MacArtney,T.J., Hofmann,K., Gartner,A., West,S.C., Helleday,T.,
            Lilley,D.M. and Rouse,J.
  TITLE     Identification of KIAA1018/FAN1, a DNA repair nuclease recruited to
            DNA damage by monoubiquitinated FANCD2
  JOURNAL   Cell 142 (1), 65-76 (2010)
   PUBMED   20603015
  REMARK    GeneRIF: Study describes how a highly conserved protein,
            KIAA1018/MTMR15/FAN1, that interacts with, and is recruited to
            sites of DNA damage by, the monoubiquitinated form of FANCD2.
REFERENCE   10 (bases 1 to 2851)
  AUTHORS   Alonso,A., Sasin,J., Bottini,N., Friedberg,I., Friedberg,I.,
            Osterman,A., Godzik,A., Hunter,T., Dixon,J. and Mustelin,T.
  TITLE     Protein tyrosine phosphatases in the human genome
  JOURNAL   Cell 117 (6), 699-711 (2004)
   PUBMED   15186772
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA841207.1, AK290987.1,
            BX647391.1 and BC044890.1.
            
            Summary: This gene encodes a member of the myotubularin-related
            class 1 cysteine-based protein tyrosine phosphatases. The encoded
            protein may be catalytically inactive. Alternatively spliced
            transcript variants have been described. [provided by RefSeq, Apr
            2009].
            
            Transcript Variant: This variant (2) differs in the 3' coding
            region and 3' UTR, compared to variant 1. The resulting isoform (b)
            has a distinct C-terminus and is shorter than isoform a. Variants
            2, 3 and 4 encode the same isoform (b).
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK290987.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-20                DA841207.1         1-20
            21-1245             AK290987.1         1-1225
            1246-2595           BX647391.1         1240-2589
            2596-2851           BC044890.1         2453-2708
FEATURES             Location/Qualifiers
     source          1..2851
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q13.2-q13.3"
     gene            1..2851
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /note="FANCD2/FANCI-associated nuclease 1"
                     /db_xref="GeneID:22909"
                     /db_xref="HGNC:29170"
                     /db_xref="MIM:613534"
     exon            1..139
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /inference="alignment:Splign:1.39.8"
     variation       104..105
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:34589857"
     exon            140..1525
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /inference="alignment:Splign:1.39.8"
     variation       206
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113045164"
     misc_feature    220..222
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /note="upstream in-frame stop codon"
     variation       270
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369326801"
     CDS             292..1893
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /EC_number="3.1.4.1"
                     /note="isoform b is encoded by transcript variant 2;
                     fanconi anemia associated nuclease 1; coiled-coil
                     domain-containing protein MTMR15; myotubularin-related
                     protein 15"
                     /codon_start=1
                     /product="fanconi-associated nuclease 1 isoform b"
                     /protein_id="NP_001139566.1"
                     /db_xref="GI:226246525"
                     /db_xref="CCDS:CCDS58344.1"
                     /db_xref="GeneID:22909"
                     /db_xref="HGNC:29170"
                     /db_xref="MIM:613534"
                     /translation="
MMSEGKPPDKKRPRRSLSISKNKKKASNSIISCFNNAPPAKLACPVCSKMVPRYDLNRHLDEMCANNDFVQVDPGQVGLINSNVSMVDLTSVTLEDVTPKKSPPPKTNLTPGQSDSAKREVKQKISPYFKSNDVVCKNQDELRNRSVKVICLGSLASKLSRKYVKAKKSIDKDEEFAGSSPQSSKSTVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRGSKIMEAESQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACHCEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQGSSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVRLFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSLAKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRFCWLLLQ
"
     misc_feature    331..357
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y2M0.4);
                     Region: D-box"
     misc_feature    412..477
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /note="Rad18-like CCHC zinc finger; Region: ZnF_Rad18;
                     smart00734"
                     /db_xref="CDD:128973"
     misc_feature    925..933
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y2M0.4);
                     Region: KEN box"
     variation       292
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139312614"
     variation       296
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143294144"
     variation       301
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369398471"
     variation       304
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149291568"
     variation       371
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139353520"
     variation       377
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199574217"
     variation       398
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146249441"
     variation       406
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183652083"
     variation       420
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200233447"
     variation       427
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371593413"
     variation       432
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144469584"
     variation       440
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148404807"
     variation       452
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376214743"
     variation       465
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143965941"
     variation       490
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146522953"
     variation       509
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201860403"
     variation       516
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376882561"
     variation       519
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367612076"
     variation       547
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139988104"
     variation       580
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375827355"
     variation       583
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199838412"
     variation       599
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200672666"
     variation       617
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76725957"
     variation       620
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151206988"
     variation       621
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139159448"
     variation       691
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144046046"
     variation       720
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:199537330"
     variation       725
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146408181"
     variation       733
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113751993"
     variation       752
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145226318"
     variation       781
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142350646"
     variation       788
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146422014"
     variation       798
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372161455"
     variation       802
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376003074"
     variation       807
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139019089"
     variation       822
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201499851"
     variation       824
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367894669"
     variation       848
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148610242"
     variation       856
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377089680"
     variation       864
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201722958"
     variation       881
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376369585"
     variation       889
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369093658"
     variation       894
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142084532"
     variation       899
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373390525"
     variation       942
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:374878731"
     variation       946
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143816528"
     variation       947
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:189713653"
     variation       957
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376528017"
     variation       963
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369869010"
     variation       976
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148140498"
     variation       989
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4779794"
     variation       992
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17846417"
     variation       1009
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150748572"
     variation       1022
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200798913"
     variation       1062
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372989498"
     variation       1073
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:137920161"
     variation       1074
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142437586"
     variation       1098
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199810253"
     variation       1127
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376256721"
     variation       1178
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145950723"
     variation       1220
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201220536"
     variation       1232
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139809129"
     variation       1235
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143534852"
     variation       1252
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144577204"
     variation       1381
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187082481"
     variation       1384
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370459391"
     variation       1401
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114136100"
     variation       1402
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142597944"
     variation       1420
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151322829"
     variation       1434
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142470367"
     variation       1452
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:192293773"
     variation       1468
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115139636"
     variation       1469
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140632948"
     variation       1475
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201153099"
     variation       1485
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141494062"
     variation       1493
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150484853"
     exon            1526..1666
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /inference="alignment:Splign:1.39.8"
     variation       1538
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200759965"
     variation       1555
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:374895181"
     variation       1561
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368417113"
     variation       1562
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138307818"
     variation       1573
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372815502"
     variation       1601
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79759675"
     variation       1616
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75820658"
     variation       1624
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200504684"
     variation       1641
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138954416"
     variation       1643
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:182455628"
     variation       1644
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142501642"
     exon            1667..2841
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /inference="alignment:Splign:1.39.8"
     variation       1690
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377131039"
     variation       1785
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199855919"
     variation       1811
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150393409"
     variation       1826
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370973001"
     variation       1843
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376174791"
     variation       1878
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79802476"
     variation       1881
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375485617"
     variation       1888
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369935463"
     variation       1889
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373034831"
     variation       1943
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3794594"
     variation       1995
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7183847"
     variation       2006..2007
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:374352331"
     variation       2058
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191452532"
     variation       2117
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3794595"
     variation       2268
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75007462"
     variation       2283
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183617582"
     variation       2344
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138151213"
     variation       2429
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61439612"
     STS             2533..2634
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /standard_name="WI-11934"
                     /db_xref="UniSTS:34421"
     variation       2605..2606
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:71838137"
     variation       2623..2624
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34387091"
     variation       2636
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1056118"
     variation       2653
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140369113"
     polyA_signal    2661..2666
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
     variation       2677
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111731930"
     variation       2784
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112451378"
     polyA_signal    2815..2820
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
     polyA_site      2841
                     /gene="FAN1"
                     /gene_synonym="KIAA1018; KMIN; MTMR15"
ORIGIN      
ggcgcgcggagccaggtgggaggtgcgaggtggccgcgcggggatcttgggtgacagggcaccgagggaaggaggacgcgagggcagccaggccctagggagcagggagagtggctcgggctcagtcgcgtggccccaggaagaagaaattgtcgagacgaataacatgaggtcatatagaatcccacttttggtgatttcaagtcaagaaagtaaaagtaaaccattgctatctttcaccttaaatatcctgtgttttattgctcagaacatccagtttttctaatactcatgatgtcagaagggaaacctcctgacaaaaaaaggcctcgtagaagcttatcaatcagcaagaataagaaaaaagcatctaattctattatttcgtgttttaacaatgcaccacctgctaaacttgcctgccccgtttgcagtaaaatggtgcctagatatgacttaaaccggcaccttgatgaaatgtgtgctaacaatgacttcgttcaagtggatccagggcaggttggcttaataaattcaaatgtgtctatggtagatttaaccagtgttaccttagaagatgtaacacctaagaagtcaccaccaccaaagacaaatttaacccctggccaaagtgattcagcaaaaagggaagtaaagcagaagatcagtccctactttaaaagtaatgatgtggtgtgcaaaaatcaagatgagctgagaaatcgtagtgtgaaagtcatttgtttgggaagcctagcatctaaattgtccagaaaatacgtaaaggctaaaaaatcaatagataaggatgaagaatttgccggttctagtccacagagttccaaatccacagttgttaagagcctgattgataactcttcagaaattgaggacgaggatcaaattttggagaacagttctcaaaaagaaaacgtgtttaaatgtgattctctaaaggaagagtgcattcctgaacatatggtaagaggaagtaaaataatggaagccgaaagccaaaaggctacccgggaatgtgagaaatcagccctcacccctggattctcagataatgcgatcatgttattctcaccagatttcactcttaggaatacattaaagtctacttcagaagacagtcttgtaaagcaagagtgtatcaaagaagtggttgaaaaacgtgaggcatgtcattgtgaagaagtaaaaatgactgttgcttcagaagctaaaatacagctgtcagattcagaggcaaaatctcatagttctgcagatgatgcttctgcatggagtaacatccaagaggctcctctgcaggatgacagttgcttaaacaatgatatccctcacagcattcctttggagcaggggtcaagctgcaatggtcctggtcaaacaaccggtcatccttactaccttcggagtttccttgtggtgctgaaaaccgtacttgagaatgaagatgatatgttgctctttgatgagcaggagaagggaattgtaactaaattttatcagttatcagctactggtcagaagttatatgtaaggctctttcaacgtaaattaagctggattaagatgaccaaattagagtatgaagagattgccttagacttaacacctgtgattgaagaattgacgaatgcaggctttctacagacagaatctgagttgcaagaactctctgaagtgcttgaactcctttctgctcctgaactaaaatccctagccaagaccttccacttggtgaatcccaatggacagaaacagcagctggtggacgcctttctcaaattggccaaacagcgttcagtctgcacttggggcaagaataagcctggaattggtgcagtgattttaaaaaggttttgttggctattgttacagtaaaaacatttaaaatgttgatagcacatattaacttacagtagattgtatacttgattgaactgtaattgtttatttcagttgtagttagattgagaaggctggaaaagccttaattgcaatagcctggattctttcttgggttattattcaaaatttttgtcgtaataccgtactaatttccaggaccaagaaaaatcggaaggcaataggcctttggtaaattgtagtattttattttccgagaaaaatacagttttaagtgattcttatgggattttaaggtaaactatttagtcaaatttttattttagtttttgtttactaaacaaagtataatcaggcagtcttaatgtgcaagttttcctgagtttaaacgtaacaatttaccaaaaactgtgagtggcttcttttgtccttgagaagcccttgacctgtttcagttgaaaattacaaaaacttttagaattgatttcttttgcccatgttatttatataatcaaactatatcaactctagcctgggaattcactactgtggagtcgaggatgaaatgagaggatgcttttgaaaacactttaacatgatgttgttatttattttatatatttgttttgtatatttcagttgttatgagcccatccttgttggggaggtgctataaatactaatctttaatgaaacataggtgtaataaggcagacattaagaaaaatataaataccaacacttgaaaaaagctcgtgttatagatttttaaaaagtacttcaataaattacatacttgtaattaattgacttgagaagtatagaatcctcatctgtgtggtatgttaaatgtcttctaagtcctttctttatctaattgtatttcttaagtatttgatgttaaccttatatgtaacattttataagcaagtaaacattaaatttagccaccctctggctgggaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:22909 -> Molecular function: GO:0000287 [magnesium ion binding] evidence: TAS
            GeneID:22909 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
            GeneID:22909 -> Molecular function: GO:0004528 [phosphodiesterase I activity] evidence: IEA
            GeneID:22909 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:22909 -> Molecular function: GO:0008409 [5'-3' exonuclease activity] evidence: IDA
            GeneID:22909 -> Molecular function: GO:0017108 [5'-flap endonuclease activity] evidence: IDA
            GeneID:22909 -> Molecular function: GO:0043130 [ubiquitin binding] evidence: IDA
            GeneID:22909 -> Biological process: GO:0000724 [double-strand break repair via homologous recombination] evidence: IMP
            GeneID:22909 -> Biological process: GO:0006281 [DNA repair] evidence: IMP
            GeneID:22909 -> Biological process: GO:0006289 [nucleotide-excision repair] evidence: IMP
            GeneID:22909 -> Biological process: GO:0033683 [nucleotide-excision repair, DNA incision] evidence: IDA
            GeneID:22909 -> Biological process: GO:0033683 [nucleotide-excision repair, DNA incision] evidence: IMP
            GeneID:22909 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_001139566 -> EC 3.1.4.1

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.