GGRNA Home | Help | Advanced search

2020-10-26 19:53:30, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001143943            3772 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens EF-hand calcium binding domain 2 (EFCAB2), transcript
            variant 2, mRNA.
ACCESSION   NM_001143943
VERSION     NM_001143943.1  GI:221316728
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3772)
  AUTHORS   Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R.
  TITLE     Personalized smoking cessation: interactions between nicotine dose,
            dependence and quit-success genotype score
  JOURNAL   Mol. Med. 16 (7-8), 247-253 (2010)
   PUBMED   20379614
  REMARK    GeneRIF: Clinical trial of gene-disease association and
            gene-environment interaction. (HuGE Navigator)
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB286332.1, AK302883.1 and AB209286.1.
            
            Transcript Variant: This variant (2) differs in the 5' UTR and uses
            an alternate 3' exon, compared to variant 1, that results in a
            frameshift. This results in a shorter isoform (b) with a distinct
            C-terminus, compared to isoform a.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK302883.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025082, ERS025083 [ECO:0000350]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-57                DB286332.1         3-59
            58-623              AK302883.1         1-566
            624-3772            AB209286.1         632-3780
FEATURES             Location/Qualifiers
     source          1..3772
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q44"
     gene            1..3772
                     /gene="EFCAB2"
                     /note="EF-hand calcium binding domain 2"
                     /db_xref="GeneID:84288"
                     /db_xref="HGNC:28166"
     exon            1..115
                     /gene="EFCAB2"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    22..24
                     /gene="EFCAB2"
                     /note="upstream in-frame stop codon"
     variation       32
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61844237"
     CDS             91..492
                     /gene="EFCAB2"
                     /note="isoform b is encoded by transcript variant 2;
                     EF-hand calcium-binding domain-containing protein 2"
                     /codon_start=1
                     /product="EF-hand calcium-binding domain-containing
                     protein 2 isoform b"
                     /protein_id="NP_001137415.1"
                     /db_xref="GI:221316729"
                     /db_xref="CCDS:CCDS44341.1"
                     /db_xref="GeneID:84288"
                     /db_xref="HGNC:28166"
                     /translation="
MADEKDREEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEDGVSLRRPG
"
     misc_feature    142..333
                     /gene="EFCAB2"
                     /note="EF-hand, calcium binding motif; A diverse
                     superfamily of calcium sensors and calcium signal
                     modulators; most examples in this alignment model have 2
                     active canonical EF hands. Ca2+ binding induces a
                     conformational change in the EF-hand motif, leading to...;
                     Region: EFh; cd00051"
                     /db_xref="CDD:28933"
     misc_feature    order(169..171,175..177,181..183,202..204,277..279,
                     283..285,292..294,313..315)
                     /gene="EFCAB2"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:28933"
     variation       105
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370582638"
     variation       106
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201927564"
     exon            116..200
                     /gene="EFCAB2"
                     /inference="alignment:Splign:1.39.8"
     variation       127
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144878367"
     variation       196
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:151181303"
     exon            201..273
                     /gene="EFCAB2"
                     /inference="alignment:Splign:1.39.8"
     variation       216
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368137710"
     variation       240
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76034141"
     variation       242
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74616990"
     variation       243
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138478256"
     variation       253
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146907907"
     exon            274..353
                     /gene="EFCAB2"
                     /inference="alignment:Splign:1.39.8"
     variation       283
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375113841"
     variation       291
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:10927387"
     variation       309
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142888002"
     variation       323
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7551261"
     exon            354..396
                     /gene="EFCAB2"
                     /inference="alignment:Splign:1.39.8"
     variation       382
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11541381"
     variation       385
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149676779"
     variation       386
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145465501"
     exon            397..463
                     /gene="EFCAB2"
                     /inference="alignment:Splign:1.39.8"
     variation       410
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368983163"
     variation       435
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373412586"
     variation       448
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200554796"
     variation       459
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369597079"
     exon            464..3772
                     /gene="EFCAB2"
                     /inference="alignment:Splign:1.39.8"
     variation       472
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:190072426"
     variation       473
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141386246"
     variation       481
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193063986"
     variation       482
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115556370"
     STS             487..678
                     /gene="EFCAB2"
                     /standard_name="D1S1361"
                     /db_xref="UniSTS:149557"
     variation       514
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143904642"
     variation       517
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145811898"
     variation       545
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:10927398"
     STS             546..634
                     /gene="EFCAB2"
                     /standard_name="D8S2279"
                     /db_xref="UniSTS:473907"
     STS             616..724
                     /gene="EFCAB2"
                     /standard_name="D11S3114"
                     /db_xref="UniSTS:152207"
     variation       631
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185684280"
     variation       632
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41305562"
     variation       643..644
                     /gene="EFCAB2"
                     /replace=""
                     /replace="tgt"
                     /replace="tgttggccaggc"
                     /db_xref="dbSNP:368090980"
     variation       646
                     /gene="EFCAB2"
                     /replace=""
                     /replace="ggccagg"
                     /db_xref="dbSNP:373396616"
     variation       652..654
                     /gene="EFCAB2"
                     /replace=""
                     /replace="tga"
                     /db_xref="dbSNP:201171474"
     variation       659
                     /gene="EFCAB2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:375962668"
     variation       694
                     /gene="EFCAB2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190605466"
     variation       706
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148015871"
     variation       710
                     /gene="EFCAB2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370360675"
     variation       751
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113046671"
     variation       814
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373541665"
     variation       1087
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374265352"
     variation       1221
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142090222"
     variation       1304
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181021109"
     variation       1337
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78779197"
     STS             1357..1528
                     /gene="EFCAB2"
                     /standard_name="SHGC-76623"
                     /db_xref="UniSTS:6708"
     variation       1452
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145732949"
     variation       1460
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79878108"
     variation       1517
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371124035"
     variation       1555
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4658701"
     variation       1601
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185091891"
     variation       1632
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:7520200"
     variation       1716
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114142382"
     variation       1719
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114400338"
     variation       1741
                     /gene="EFCAB2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138661068"
     variation       1822
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187992294"
     variation       1835
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142887825"
     variation       1854
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181256172"
     variation       1894
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:80256961"
     variation       1911
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147019975"
     variation       1924
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:367891784"
     variation       1998
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138024843"
     variation       2002
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149517507"
     variation       2041
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367599098"
     variation       2072
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186414998"
     variation       2086
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144060845"
     variation       2149
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148524782"
     variation       2199
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142862259"
     variation       2217
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146046386"
     variation       2220
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:191709019"
     variation       2221..2222
                     /gene="EFCAB2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34921749"
     variation       2228
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:181779324"
     variation       2296
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113346437"
     variation       2338
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375965209"
     variation       2372
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112404729"
     variation       2402
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113254444"
     variation       2415
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139348640"
     variation       2419
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187397899"
     variation       2449..2450
                     /gene="EFCAB2"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:113565574"
     variation       2454..2455
                     /gene="EFCAB2"
                     /replace=""
                     /replace="ta"
                     /db_xref="dbSNP:71683275"
     variation       2509
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114927989"
     variation       2666
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:111806462"
     variation       2716
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12125365"
     variation       2749
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113753800"
     variation       2750
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12117676"
     variation       2806
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111320109"
     variation       2834
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:10803267"
     variation       2847
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113267665"
     variation       2873
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191041134"
     variation       2895
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145905528"
     variation       2914
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147768586"
     variation       2934
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116173775"
     variation       2935
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73123030"
     variation       2955
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141160097"
     variation       2960
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143591662"
     variation       3015
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:148052969"
     variation       3019
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183228992"
     variation       3048
                     /gene="EFCAB2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113535512"
     variation       3049
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186835210"
     variation       3100
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150129497"
     variation       3267..3268
                     /gene="EFCAB2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:376113065"
     variation       3273
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189734770"
     variation       3283
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115868098"
     variation       3303
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1140879"
     variation       3333
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112707726"
     variation       3347
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200763851"
     variation       3357
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12734969"
     variation       3395
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142850256"
     variation       3481
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945953"
     variation       3564
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146103758"
     variation       3573
                     /gene="EFCAB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78006028"
     variation       3682
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61736927"
     variation       3705
                     /gene="EFCAB2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:182775806"
     variation       3713
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370408914"
     variation       3735
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6672147"
     variation       3770
                     /gene="EFCAB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:112959595"
ORIGIN      
gccaggctcgccgcggggcgctgagcaggccgggacaccgcggccgaggttatcgttaggcatctcccaggcgaccggctccgcagcaagatggcggacgagaaggacagggaagagataatagtagcagaatttcacaaaaaaatcaaagaggcatttgaagtctttgaccatgagtcgaataatacagtggatgtgagagagattggaacaattatcaggtcattaggatgctgtcctacggaaggagagctgcatgatctgattgcagaggtagaggaagaagaacccactggatacattcgattcgaaaaatttcttccggtgatgacagaaatactactagaaagaaaatacagaccaattccagaagatgtccttcttcgagcttttgaggttttagattcagctaaacgtgggtttcttactaaggacgagctgatcaagtatatgactgaagaagatggagtttcgctccgtcgcccaggctgaagtgcagtggcgtgatcttggctcgttgcaacctccacctcccgggttcaagagattctcctgcctcagcctcctgagcagctgggatgacaggcacacaccaccacgcctggctaatttctgtatttttagtagagacggggtttcaccatggtctggtgacctcctggtctcgaactcctgacctcaagtgatcctcccgcctcagcctcccaaagttctgggattacaggcatgagccaccgcacccggctgcttccttaactcttgatctcctctctgtatcttgctttgtctagctgttctcttctctccatattcatccaaacatttgcttagaagtacccagaagcatggcgttgaatgtggtacaccttgaacgaagggtgaagaaacgaggcagagtgacttagtagcaagtgacagcacacagtttaaattttaatattagcccatttacaaacaacagcttatataatagtcattcacatacctcaacactcaccatcccctccccactttttttctggagacagggtttcactgtcaccccagctggaatgcaggtggcatgatcacagctcactgtagcatcgacctcctggactcaaggggtcctcgcgcctcagcctcctgagtagctgggaccacaggtgcatgccaccacgcccagctaatgtttttttttattttttgtagagacagggtctggctatgttgcttaggctggtctcaaactcctgggttcaagcgatcctgccacctcagcctcccaaagtgttaggattacagatgtgagccactgtgcccagccaacattcaccccattcaagtgtgcaattcaatggattctagtatcttcacagtgctgtgcaactatcactcctatctacttacaaagcatttccatcatcttaaaaagaatccccatgtccaatagcagttccccttcccccaccgtcatcctcgggcaaccgctaatcttcctgtgtgtctgtggatttgcctcttcagggcatttcacataaacacaatcatacaatatgtggccttctgtgtctggcttctttcatttagtgtaaggcttttgaggttcatccatgttgtaatgtatatccttagttcattcttttttgttaagctcacaaataaaaagcctcactttttatttgaggcaaggagactggctacagggattacagttccagcagtcaaaacgcaactccaagtggcactatttggaccgtaggttttgcttcattttggctggaaaagggtattcaggatgtacttctcccagccggacaagaaaaagggcaaagaaaactggaagagacgtctcgtctacacaaactgctctttggacacagcatcaacctgaccacacccgtgctggccagtctgcaggttgctgacccgccgttaagggacacaggccatactacacttgctagaaaaactgaggcaggaaaaagaggtgcaaggcactgggggaagagcaggtacctatagctttaaagctcagtgttgaaggggtaatccttgcaggaggcacagctcaccaagacacagaccctcccgttcctgttgtagctgactacagtggtcacatcaggctgctcagttgaaagtcgaagtcctccaagttttcagcagtgcgttccagcatcaccaccgaaatgatgataggaattaccaccaaattcctatgcatgggaaaccagatcagaacctgggctgcgtttttatttgtttattttttttactgtgcttggctgtgattgctttggtgctgggatcccccagacctgtcacgagagctgaggggactacaggcagtcaccaccttgcctttggattggcagccctggattaacttctcctgaggtgggtgcaggtggcactcactgtggttaaccactgtttttaagccaggtttctttttttctgtctgtcatatatatatatatatatttagagacagggtctcactctatcactcaggcctggagtgtagtggcatgatcataactcactgcagcctcgagttcctgggctcaagtgatcctcccgccttggcctcccaaagtgctgggattacaggctgagacaccacacctggtcttaagccaggtttctttaccatctcttggagatggctgcagttggagattccaaaagctttcagagcccttcatccaccagctcctccatgtggccacccatgtgacatgaagttggtgtcactaggtaccacgttgtctgtcccatccaacaggaaaaatagcctgttggccagtgaataaggtaggaatccaggtggtcccctgagggtcttctgacaggctcctttatcaggctcttctcatggtatgagcaccgcagcttgctgacagtggcaacgttctcaagcttcacagactccgtcacttggcctggaggggaattctaggtgtccagccccaggacaggcattttggcaccatgattgagcacgatatggtgagccatcctcacaggattaagaagaattctggacagaaatatagttgtaagtaagcatcagtcagcctgcactttgacccacttccttgtaaccaacagtgacgtagcactaggtaacatttgcatccccgttgttcctatagatacaatttctgaccttagaatcacaaggcttttgtttaaaatagatgggatctctgacattagaatcataagatttttgtttaagacttgcttaagatgtttttcagatcctgaattccagcaaaacagccgacaccaaccagtttgaagacccccacagaggaatgtgatcagcatgaaaatacagcttcgtctccctctcccatgactccaccctgcacacttcgaccaatcaaccatctccacactccagtctccactcccaaacccttaaaaaccccagccccaaactcctcagggagatggatttgacgtttcctcccatttcctccttcggtggccctacgatgaaacctctttctctgctacaaccctatgcctcggcgtattcactttctggtcccatccagcgatggacccatcgtggttaccgtggctggccaagcctgctgtgcttcacagaccccactcaggatcacaccacttcgttccactgtttggagatgccatgtttgcttatcccttcatcagctgatgagcatttgtgctgttttcactttttggctattacgaaaatgttgctacgagcatccatgatattcgcccatttaaaaaagtgtttttcaccatt
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:84288 -> Molecular function: GO:0005509 [calcium ion binding] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.