2024-04-27 10:58:45, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001143832 672 bp mRNA linear PRI 13-APR-2013 DEFINITION Homo sapiens leucine twenty homeobox (LEUTX), mRNA. ACCESSION NM_001143832 VERSION NM_001143832.1 GI:219802097 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 672) AUTHORS Holland,P.W., Booth,H.A. and Bruford,E.A. TITLE Classification and nomenclature of all human homeobox genes JOURNAL BMC Biol. 5, 47 (2007) PUBMED 17963489 REMARK Publication Status: Online-Only COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH471126.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: CR746510.1, H02655.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..672 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19q13.2" gene 1..672 /gene="LEUTX" /note="leucine twenty homeobox" /db_xref="GeneID:342900" /db_xref="HGNC:31953" exon 1..82 /gene="LEUTX" /inference="alignment:Splign:1.39.8" variation 30 /gene="LEUTX" /replace="c" /replace="t" /db_xref="dbSNP:74763077" variation 31 /gene="LEUTX" /replace="a" /replace="g" /db_xref="dbSNP:148289253" variation 34 /gene="LEUTX" /replace="a" /replace="g" /db_xref="dbSNP:61732544" exon 83..234 /gene="LEUTX" /inference="alignment:Splign:1.39.8" variation 101 /gene="LEUTX" /replace="a" /replace="g" /db_xref="dbSNP:17709621" variation 110 /gene="LEUTX" /replace="a" /replace="g" /db_xref="dbSNP:117937250" CDS 166..672 /gene="LEUTX" /note="putative leucine-twenty homeobox; arginine-fifty homeobox-like pseudogene" /codon_start=1 /product="leucine-twenty homeobox" /protein_id="NP_001137304.1" /db_xref="GI:219802098" /db_xref="GeneID:342900" /db_xref="HGNC:31953" /translation="
MHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSLNQYLFPVCLEYDQLQSSV
" misc_feature <166..243 /gene="LEUTX" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cl00084" /db_xref="CDD:206827" variation 197 /gene="LEUTX" /replace="" /replace="t" /db_xref="dbSNP:35726156" variation 226 /gene="LEUTX" /replace="a" /replace="g" /db_xref="dbSNP:117228099" exon 235..672 /gene="LEUTX" /inference="alignment:Splign:1.39.8" variation 277 /gene="LEUTX" /replace="a" /replace="c" /db_xref="dbSNP:376692805" variation 320 /gene="LEUTX" /replace="a" /replace="c" /db_xref="dbSNP:369685173" variation 377 /gene="LEUTX" /replace="a" /replace="g" /db_xref="dbSNP:373629971" variation 439 /gene="LEUTX" /replace="a" /replace="g" /db_xref="dbSNP:141754227" variation 459 /gene="LEUTX" /replace="c" /replace="t" /db_xref="dbSNP:147098601" variation 561 /gene="LEUTX" /replace="a" /replace="c" /db_xref="dbSNP:376613498" variation 604 /gene="LEUTX" /replace="a" /replace="c" /db_xref="dbSNP:61995735" variation 638 /gene="LEUTX" /replace="a" /replace="g" /db_xref="dbSNP:147692654" variation 654 /gene="LEUTX" /replace="a" /replace="g" /db_xref="dbSNP:377434841" ORIGIN
actgcacacggttttcagcctcatgcctccgtggaacctgcctgtcaggcgggcacctggaatctcaagcaactttctcaagaagggccaaggcgttatcgtcggccacgcacaagatttctctccaaacaactcacagcattgagagaattgcttgaaaagaccatgcacccaagtttggctacaatggggaaactggcttcaaagctacaacttgatctatccgtagtaaagatctggttcaagaaccagcgtgccaaatggaagaggcagcagcggcagcaaatgcagacacggccatcactagggccagcaaaccagacaacttcagtgaagaaggaggagactccctcagccataactactgcaaacattcgtccagtaagtcctggaatctctgatgcaaatgaccatgatctacgtgagccttctggtatcaagaatcctggaggagccagcgcctctgcgagggtttcatcctgggattctcagtcatatgacattgaacagatatgtctgggggcttcaaatcctccttgggcctccactctctttgaaatagatgaatttgtaaagatctatgacttgccaggggaagatgacaccagcagcctaaatcaatatctttttccagtatgccttgagtatgaccagctccaatcttcagtgtaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:342900 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:342900 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA GeneID:342900 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.