2024-04-26 08:09:57, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001139457 1828 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens B-cell receptor-associated protein 31 (BCAP31), transcript variant 1, mRNA. ACCESSION NM_001139457 VERSION NM_001139457.2 GI:374253795 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1828) AUTHORS Gajate,C., Matos-da-Silva,M., Dakir,el.-H., Fonteriz,R.I., Alvarez,J. and Mollinedo,F. TITLE Antitumor alkyl-lysophospholipid analog edelfosine induces apoptosis in pancreatic cancer by targeting endoplasmic reticulum JOURNAL Oncogene 31 (21), 2627-2639 (2012) PUBMED 22056873 REFERENCE 2 (bases 1 to 1828) AUTHORS Grimm,S. TITLE The ER-mitochondria interface: the social network of cell death JOURNAL Biochim. Biophys. Acta 1823 (2), 327-334 (2012) PUBMED 22182703 REMARK Review article REFERENCE 3 (bases 1 to 1828) AUTHORS Geiger,R., Andritschke,D., Friebe,S., Herzog,F., Luisoni,S., Heger,T. and Helenius,A. TITLE BAP31 and BiP are essential for dislocation of SV40 from the endoplasmic reticulum to the cytosol JOURNAL Nat. Cell Biol. 13 (11), 1305-1314 (2011) PUBMED 21947079 REMARK GeneRIF: BAP31 and BiP are essential for dislocation of SV40 from the endoplasmic reticulum to the cytosol. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1828) AUTHORS Corzo,D., Gibson,W., Johnson,K., Mitchell,G., LePage,G., Cox,G.F., Casey,R., Zeiss,C., Tyson,H., Cutting,G.R., Raymond,G.V., Smith,K.D., Watkins,P.A., Moser,A.B., Moser,H.W. and Steinberg,S.J. TITLE Contiguous deletion of the X-linked adrenoleukodystrophy gene (ABCD1) and DXS1357E: a novel neonatal phenotype similar to peroxisomal biogenesis disorders JOURNAL Am. J. Hum. Genet. 70 (6), 1520-1531 (2002) PUBMED 11992258 REMARK GeneRIF: Contiguous deletion of the X-linked adrenoleukodystrophy gene (ABCD1) and DXS1357E: a novel neonatal phenotype similar to peroxisomal biogenesis disorders. REFERENCE 5 (bases 1 to 1828) AUTHORS Granville,D.J., Carthy,C.M., Jiang,H., Shore,G.C., McManus,B.M. and Hunt,D.W. TITLE Rapid cytochrome c release, activation of caspases 3, 6, 7 and 8 followed by Bap31 cleavage in HeLa cells treated with photodynamic therapy JOURNAL FEBS Lett. 437 (1-2), 5-10 (1998) PUBMED 9804161 REFERENCE 6 (bases 1 to 1828) AUTHORS Annaert,W.G., Becker,B., Kistner,U., Reth,M. and Jahn,R. TITLE Export of cellubrevin from the endoplasmic reticulum is controlled by BAP31 JOURNAL J. Cell Biol. 139 (6), 1397-1410 (1997) PUBMED 9396746 REFERENCE 7 (bases 1 to 1828) AUTHORS Ng,F.W., Nguyen,M., Kwan,T., Branton,P.E., Nicholson,D.W., Cromlish,J.A. and Shore,G.C. TITLE p28 Bap31, a Bcl-2/Bcl-XL- and procaspase-8-associated protein in the endoplasmic reticulum JOURNAL J. Cell Biol. 139 (2), 327-338 (1997) PUBMED 9334338 REFERENCE 8 (bases 1 to 1828) AUTHORS Li,E., Bestagno,M. and Burrone,O. TITLE Molecular cloning and characterization of a transmembrane surface antigen in human cells JOURNAL Eur. J. Biochem. 238 (3), 631-638 (1996) PUBMED 8706661 REFERENCE 9 (bases 1 to 1828) AUTHORS Adachi,T., Schamel,W.W., Kim,K.M., Watanabe,T., Becker,B., Nielsen,P.J. and Reth,M. TITLE The specificity of association of the IgD molecule with the accessory proteins BAP31/BAP29 lies in the IgD transmembrane sequence JOURNAL EMBO J. 15 (7), 1534-1541 (1996) PUBMED 8612576 REFERENCE 10 (bases 1 to 1828) AUTHORS Mosser,J., Sarde,C.O., Vicaire,S., Yates,J.R. and Mandel,J.L. TITLE A new human gene (DXS1357E) with ubiquitous expression, located in Xq28 adjacent to the adrenoleukodystrophy gene JOURNAL Genomics 22 (2), 469-471 (1994) PUBMED 7806238 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BG779815.1, AK057613.1 and AI123868.1. On Jan 28, 2012 this sequence version replaced gi:213511507. Summary: This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. [provided by RefSeq, Jan 2012]. Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (a). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK057613.1, AK223059.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 BG779815.1 1-7 8-1818 AK057613.1 1-1811 1819-1828 AI123868.1 1-10 c FEATURES Location/Qualifiers source 1..1828 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="X" /map="Xq28" gene 1..1828 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /note="B-cell receptor-associated protein 31" /db_xref="GeneID:10134" /db_xref="HGNC:16695" /db_xref="MIM:300398" exon 1..594 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /inference="alignment:Splign:1.39.8" variation 345 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /replace="c" /replace="t" /db_xref="dbSNP:11537729" misc_feature 366..368 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /note="upstream in-frame stop codon" CDS 438..1379 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /note="isoform a is encoded by transcript variant 1; BCR-associated protein Bap31; p28 Bap31; 6C6-AG tumor-associated antigen" /codon_start=1 /product="B-cell receptor-associated protein 31 isoform a" /protein_id="NP_001132929.1" /db_xref="GI:213511508" /db_xref="CCDS:CCDS48191.1" /db_xref="GeneID:10134" /db_xref="HGNC:16695" /db_xref="MIM:300398" /translation="
MGAEASSSWCPGTALPEERLSVKRASEISGFLGQGSSGEAALDVLTHVLEGAGNKLTSSCGKPSSNRMSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
" misc_feature 639..1310 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /note="B-cell receptor-associated protein 31-like; Region: Bap31; pfam05529" /db_xref="CDD:203268" exon 595..730 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /inference="alignment:Splign:1.39.8" exon 731..831 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /inference="alignment:Splign:1.39.8" exon 832..979 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /inference="alignment:Splign:1.39.8" variation 839 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /replace="a" /replace="g" /db_xref="dbSNP:11537725" variation 963 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /replace="c" /replace="t" /db_xref="dbSNP:11537726" exon 980..1115 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /inference="alignment:Splign:1.39.8" variation 1019 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /replace="c" /replace="t" /db_xref="dbSNP:11537730" variation 1043 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /replace="c" /replace="t" /db_xref="dbSNP:11537731" exon 1116..1239 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /inference="alignment:Splign:1.39.8" exon 1240..1340 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /inference="alignment:Splign:1.39.8" exon 1341..1824 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /inference="alignment:Splign:1.39.8" STS 1367..1562 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /standard_name="RH79936" /db_xref="UniSTS:88296" variation 1401 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /replace="c" /replace="t" /db_xref="dbSNP:11537732" STS 1511..1740 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /standard_name="RH77716" /db_xref="UniSTS:88176" variation 1546 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /replace="a" /replace="g" /db_xref="dbSNP:11537728" variation 1606 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /replace="g" /replace="t" /db_xref="dbSNP:1064720" variation 1637 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /replace="c" /replace="t" /db_xref="dbSNP:13126" STS 1649..1804 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" /standard_name="DXS7452" /db_xref="UniSTS:99348" polyA_signal 1797..1802 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" polyA_site 1819 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" polyA_site 1824 /gene="BCAP31" /gene_synonym="6C6-AG; BAP31; CDM; DXS1357E" ORIGIN
gatgggcctccgggacggtgtgccaggccggggccaagtcggaggcccctcgctctgggtgggcgctggggcccgcgagggctactgtaaggacccctggcttctgaggatactgcgtctagaactttctccgtatggggccttgaggtgcttggtcgagacctgcctttgcgcttggtcccgaatcctgccctctaggagtcgctcttgcgggcctccagcccaccggaggcgaagcggccccgggcggaaggccgctggatcctcgagggaggtgccggtttctctccgcgggcgccgtggggacggtgggaggcgggggcgtcggcagcgcttggactaggtgcggccttgggcctgcctggtagcggggatttgggcccgcagagcgcccgcctctgcggctgagttctgcctggcggggaagggagcgcccgatgggtgccgaggcgtcctcctcttggtgccctggcactgctcttcccgaagaacgcctttcagttaaacgggcgtcggaaatctcgggcttcctggggcagggatcgtcgggagaggccgctctggacgtgttgacacacgtgctggagggggcaggaaacaagctcacatcttcctgtgggaaaccttctagcaacaggatgagtctgcagtggactgcagttgccaccttcctctatgcggaggtctttgttgtgttgcttctctgcattcccttcatttctcctaaaagatggcagaagattttcaagtcccggctggtggagttgttagtgtcctatggcaacaccttctttgtggttctcattgtcatccttgtgctgttggtcatcgatgccgtgcgcgaaattcggaagtatgatgatgtgacggaaaaggtgaacctccagaacaatcccggggccatggagcacttccacatgaagcttttccgtgcccagaggaatctctacattgctggcttttccttgctgctgtccttcctgcttagacgcctggtgactctcatttcgcagcaggccacgctgctggcctccaatgaagcctttaaaaagcaggcggagagtgctagtgaggcggccaagaagtacatggaggagaatgaccagctcaagaagggagctgctgttgacggaggcaagttggatgtcgggaatgctgaggtgaagttggaggaagagaacaggagcctgaaggctgacctgcagaagctaaaggacgagctggccagcactaagcaaaaactagagaaagctgaaaaccaggttctggccatgcggaagcagtctgagggcctcaccaaggagtacgaccgcttgctggaggagcacgcaaagctgcaggctgcagtagatggtcccatggacaagaaggaagagtaagggcctccttcctcccctgcctgcagctggcttccacctggcacgtgcctgctgcttcctgagagcccggcctctccctccagtacttctgtttgtgcccttctgcttcccccattcccttccacagctcatagctcgtcatctcggcccttgtccacactctccaagcacattacaggggacctgattgctacacgttcagaatgcgtttgctgtcatcctgcttggcctggccaggcctggcacagccttggcttccacgcctgagcgtggagagcacgagttagttgtagtccggcttgcggtggggctgacttcctgttggtttgagcccctttttgttttgccctctgggtgttttctttggtcccgcaggagggtgggtggagcaggtggactggagtttctcttgagggcaataaaagttgtcatggtgtgtacgtggaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:10134 -> Molecular function: GO:0005102 [receptor binding] evidence: NAS GeneID:10134 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:10134 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS GeneID:10134 -> Biological process: GO:0006886 [intracellular protein transport] evidence: IEA GeneID:10134 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:10134 -> Biological process: GO:0006921 [cellular component disassembly involved in execution phase of apoptosis] evidence: TAS GeneID:10134 -> Biological process: GO:0006955 [immune response] evidence: NAS GeneID:10134 -> Biological process: GO:0007204 [elevation of cytosolic calcium ion concentration] evidence: IMP GeneID:10134 -> Biological process: GO:0007283 [spermatogenesis] evidence: IEA GeneID:10134 -> Biological process: GO:0016192 [vesicle-mediated transport] evidence: IEA GeneID:10134 -> Biological process: GO:0032471 [reduction of endoplasmic reticulum calcium ion concentration] evidence: IMP GeneID:10134 -> Biological process: GO:0035584 [calcium-mediated signaling using intracellular calcium source] evidence: IMP GeneID:10134 -> Biological process: GO:0043280 [positive regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IMP GeneID:10134 -> Biological process: GO:0051561 [elevation of mitochondrial calcium ion concentration] evidence: IMP GeneID:10134 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: IMP GeneID:10134 -> Cellular component: GO:0000139 [Golgi membrane] evidence: IEA GeneID:10134 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IDA GeneID:10134 -> Cellular component: GO:0005789 [endoplasmic reticulum membrane] evidence: TAS GeneID:10134 -> Cellular component: GO:0005811 [lipid particle] evidence: IDA GeneID:10134 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:10134 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: IDA GeneID:10134 -> Cellular component: GO:0033116 [endoplasmic reticulum-Golgi intermediate compartment membrane] evidence: IEA GeneID:10134 -> Cellular component: GO:0071556 [integral to lumenal side of endoplasmic reticulum membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.