GGRNA | NM_001135702.1

LOCUS       NM_001135702            3042 bp    mRNA    linear   PRI 01-JUL-2013
DEFINITION  Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
            activation protein, zeta polypeptide (YWHAZ), transcript variant 6,
            mRNA.
ACCESSION   NM_001135702
VERSION     NM_001135702.1  GI:208973243
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3042)
  AUTHORS   Riou,P., Kjaer,S., Garg,R., Purkiss,A., George,R., Cain,R.J.,
            Bineva,G., Reymond,N., McColl,B., Thompson,A.J., O'Reilly,N.,
            McDonald,N.Q., Parker,P.J. and Ridley,A.J.
  TITLE     14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif
            to inhibit G proteins
  JOURNAL   Cell 153 (3), 640-653 (2013)
   PUBMED   23622247
  REMARK    GeneRIF: Study reports a high-affinity 14-3-3-binding site at the C
            terminus of Rnd3 consisting of both the Cys241-farnesyl moiety and
            a Rho-associated coiled coil containing protein kinase
            (ROCK)-dependent Ser240 phosphorylation site.
REFERENCE   2  (bases 1 to 3042)
  AUTHORS   Nishimura,Y., Komatsu,S., Ichikawa,D., Nagata,H., Hirajima,S.,
            Takeshita,H., Kawaguchi,T., Arita,T., Konishi,H., Kashimoto,K.,
            Shiozaki,A., Fujiwara,H., Okamoto,K., Tsuda,H. and Otsuji,E.
  TITLE     Overexpression of YWHAZ relates to tumor cell proliferation and
            malignant outcome of gastric carcinoma
  JOURNAL   Br. J. Cancer 108 (6), 1324-1331 (2013)
   PUBMED   23422756
  REMARK    GeneRIF: Overexpression of YWHAZ relates to tumor cell
            proliferation and malignant outcome of gastric carcinoma.
REFERENCE   3  (bases 1 to 3042)
  AUTHORS   Bergamaschi,A., Frasor,J., Borgen,K., Stanculescu,A., Johnson,P.,
            Rowland,K., Wiley,E.L. and Katzenellenbogen,B.S.
  TITLE     14-3-3zeta as a predictor of early time to recurrence and distant
            metastasis in hormone receptor-positive and -negative breast
            cancers
  JOURNAL   Breast Cancer Res. Treat. 137 (3), 689-696 (2013)
   PUBMED   23271328
  REMARK    GeneRIF: 14-3-3zeta as a predictor of early time to recurrence and
            distant metastasis in hormone receptor-positive and -negative
            breast cancers.
REFERENCE   4  (bases 1 to 3042)
  AUTHORS   Boon,S.S. and Banks,L.
  TITLE     High-risk human papillomavirus E6 oncoproteins interact with
            14-3-3zeta in a PDZ binding motif-dependent manner
  JOURNAL   J. Virol. 87 (3), 1586-1595 (2013)
   PUBMED   23175360
  REMARK    GeneRIF: The interaction is direct and specific for the high-risk
            HPV E6 oncoproteins, although there are significant differences in
            the efficiencies with which HPV-16, HPV-18, and HPV-31 E6
            oncoproteins can associate with 14-3-3zeta.
REFERENCE   5  (bases 1 to 3042)
  AUTHORS   Skwarczynska,M., Molzan,M. and Ottmann,C.
  TITLE     Activation of NF-kappaB signalling by fusicoccin-induced
            dimerization
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 110 (5), E377-E386 (2013)
   PUBMED   23269842
  REMARK    GeneRIF: Data indicate that fusicoccin (FC)-mediated dimerization
            of the NF-kappaB-C terminus(CT) with a constitutively
            nuclear-localized 14-3-3 protein led to an NF-kappaB-specific
            cellular response by inducing IL-8 secretion.
REFERENCE   6  (bases 1 to 3042)
  AUTHORS   Koyama,S., Williams,L.T. and Kikuchi,A.
  TITLE     Characterization of the interaction of Raf-1 with ras p21 or 14-3-3
            protein in intact cells
  JOURNAL   FEBS Lett. 368 (2), 321-325 (1995)
   PUBMED   7628630
REFERENCE   7  (bases 1 to 3042)
  AUTHORS   Liu,D., Bienkowska,J., Petosa,C., Collier,R.J., Fu,H. and
            Liddington,R.
  TITLE     Crystal structure of the zeta isoform of the 14-3-3 protein
  JOURNAL   Nature 376 (6536), 191-194 (1995)
   PUBMED   7603574
REFERENCE   8  (bases 1 to 3042)
  AUTHORS   Sato,T., Irie,S., Kitada,S. and Reed,J.C.
  TITLE     FAP-1: a protein tyrosine phosphatase that associates with Fas
  JOURNAL   Science 268 (5209), 411-415 (1995)
   PUBMED   7536343
REFERENCE   9  (bases 1 to 3042)
  AUTHORS   Kawamoto,S., Shoji,M., Setoguchi,Y., Kato,M., Hashizume,S.,
            Ichikawa,A., Osada,K., Katakura,Y., Tachibana,H. and Murakami,H.
  TITLE     Molecular cloning of the 31 kDa cytosolic phospholipase A2, as an
            antigen recognized by the lung cancer-specific human monoclonal
            antibody, AE6F4
  JOURNAL   Cytotechnology 17 (2), 103-108 (1995)
   PUBMED   7547034
REFERENCE   10 (bases 1 to 3042)
  AUTHORS   Zupan,L.A., Steffens,D.L., Berry,C.A., Landt,M. and Gross,R.W.
  TITLE     Cloning and expression of a human 14-3-3 protein mediating
            phospholipolysis. Identification of an arachidonoyl-enzyme
            intermediate during catalysis
  JOURNAL   J. Biol. Chem. 267 (13), 8707-8710 (1992)
   PUBMED   1577711
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DB472116.1, BQ605329.1,
            BC072426.1 and BM783874.1.
            
            Summary: This gene product belongs to the 14-3-3 family of proteins
            which mediate signal transduction by binding to
            phosphoserine-containing proteins. This highly conserved protein
            family is found in both plants and mammals, and this protein is 99%
            identical to the mouse, rat and sheep orthologs. The encoded
            protein interacts with IRS1 protein, suggesting a role in
            regulating insulin sensitivity. Several transcript variants that
            differ in the 5' UTR but that encode the same protein have been
            identified for this gene. [provided by RefSeq, Oct 2008].
            
            Transcript Variant: This variant (6) differs in the 5' UTR compared
            to variant 2. All six transcripts encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AL553839.3, DR762546.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-55                DB472116.1         18-72
            56-75               BQ605329.1         395-414             c
            76-166              DB472116.1         93-183
            167-2925            BC072426.1         97-2855
            2926-3042           BM783874.1         221-337
FEATURES             Location/Qualifiers
     source          1..3042
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q23.1"
     gene            1..3042
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
                     activation protein, zeta polypeptide"
                     /db_xref="GeneID:7534"
                     /db_xref="HGNC:12855"
                     /db_xref="MIM:601288"
     exon            1..166
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    16..18
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /note="upstream in-frame stop codon"
     exon            167..471
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /inference="alignment:Splign:1.39.8"
     CDS             178..915
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /note="14-3-3 delta; tyrosine 3-monooxygenase/tryptophan
                     5-monooxygenase activation protein, delta polypeptide;
                     14-3-3 zeta; phospholipase A2; protein kinase C inhibitor
                     protein-1; tyrosine 3/tryptophan 5 -monooxygenase
                     activation protein, zeta polypeptide; 14-3-3
                     protein/cytosolic phospholipase A2; protein kinase C
                     inhibitor protein 1"
                     /codon_start=1
                     /product="14-3-3 protein zeta/delta"
                     /protein_id="NP_001129174.1"
                     /db_xref="GI:208973244"
                     /db_xref="CCDS:CCDS6290.1"
                     /db_xref="GeneID:7534"
                     /db_xref="HGNC:12855"
                     /db_xref="MIM:601288"
                     /translation="

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

"
     misc_feature    178..180
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylmethionine; propagated from
                     UniProtKB/Swiss-Prot (P63104.1); acetylation site"
     misc_feature    181..867
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /note="14-3-3 beta and zeta isoforms of 14-3-3 protein;
                     Region: 14-3-3_beta_zeta; cd10022"
                     /db_xref="CDD:206758"
     misc_feature    184..186
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (P63104.1); acetylation site"
     misc_feature    order(190..192,199..204,211..216,220..225,229..231,
                     238..240,349..351,358..360,370..372,400..402,409..414,
                     421..423,430..435,442..444)
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206758"
     misc_feature    order(298..303,310..315,322..324,526..528,535..537,
                     556..561,670..672,682..684,691..696,703..705,802..816,
                     823..828,835..837,847..849)
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206758"
     misc_feature    343..345
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Interaction with phosphoserine on interacting
                     protein (By similarity); propagated from
                     UniProtKB/Swiss-Prot (P63104.1); other site"
     misc_feature    349..351
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by PKA and PKB/AKT1; propagated from
                     UniProtKB/Swiss-Prot (P63104.1); phosphorylation site"
     misc_feature    379..381
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (P63104.1); acetylation site"
     misc_feature    556..558
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Interaction with phosphoserine on interacting
                     protein (By similarity); propagated from
                     UniProtKB/Swiss-Prot (P63104.1); other site"
     misc_feature    727..729
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by MAPK8; propagated from
                     UniProtKB/Swiss-Prot (P63104.1); phosphorylation site"
     misc_feature    796..798
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P63104.1); phosphorylation site"
     misc_feature    871..873
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine, by CK1; propagated from
                     UniProtKB/Swiss-Prot (P63104.1); phosphorylation site"
     STS             378..621
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /standard_name="PMC150726P7"
                     /db_xref="UniSTS:271079"
     variation       404
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11551365"
     variation       438
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41473144"
     exon            472..595
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /inference="alignment:Splign:1.39.8"
     exon            596..759
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /inference="alignment:Splign:1.39.8"
     exon            760..855
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /inference="alignment:Splign:1.39.8"
     exon            856..3032
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /inference="alignment:Splign:1.39.8"
     variation       1001
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11551354"
     STS             1184..1277
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /standard_name="PMC126239P3"
                     /db_xref="UniSTS:270535"
     variation       1273
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11551357"
     STS             1303..2051
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /standard_name="YWHAZ_1120.2"
                     /db_xref="UniSTS:281082"
     variation       1382
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11545396"
     polyA_signal    1888..1893
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
     polyA_site      1919
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
     variation       2402
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551356"
     variation       2687
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1062376"
     variation       2707
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1062382"
     variation       2833
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1139382"
     variation       2849
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1062393"
     polyA_signal    2862..2867
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
     polyA_site      2885
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
     polyA_site      2925
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
     variation       2927
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3203463"
     polyA_signal    3014..3019
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
     polyA_site      3032
                     /gene="YWHAZ"
                     /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
ORIGIN

gacacagatccgccatgacaaaggaggagagtcggggacttgagccgtggctccgacttgggcggagcctggaggggggtggttgcgatacgcggaccggagaatttgcactttaaagtccgggtctgcccgttttcgtttcacagtaaccgacgtctcaagtcagaacatccagtcatggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgatgacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggagaggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagggtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcgagaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctcttttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaaatgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaagggattgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatgcaaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgagattctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccattgctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaattactgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcaggagaaggaggggaaaattaaccggccttccaacttttgtctgcctcattctaaaatttacacagtagaccatttgtcatccatgctgtcccacaaatagttttttgtttacgatttatgacaggtttatgttacttctatttgaatttctatatttcccatgtggtttttatgtttaatattaggggagtagagccagttaacatttagggagttatctgttttcatcttgaggtggccaatatggggatgtggaatttttatacaagttataagtgtttggcatagtacttttggtacattgtggcttcaaaagggccagtgtaaaactgcttccatgtctaagcaaagaaaactgcctacatactggtttgtcctggcggggaataaaagggatcattggttccagtcacaggtgtagtaattgtgggtactttaaggtttggagcacttacaaggctgtggtagaatcataccccatggataccacatattaaaccatgtatatctgtggaatactcaatgtgtacacctttgactacagctgcagaagtgttcctttagacaaagttgtgacccattttactctggataagggcagaaacggttcacattccattatttgtaaagttacctgctgttagctttcattatttttgctacactcattttatttgtatttaaatgttttaggcaacctaagaacaaatgtaaaagtaaagatgcaggaaaaatgaattgcttggtattcattacttcatgtatatcaagcacagcagtaaaacaaaaacccatgtatttaacttttttttaggatttttgcttttgtgatttttttttttttgatacttgcctaacatgcatgtgctgtaaaaatagttaacagggaaataacttgagatgatggctagctttgtttaatgtcttatgaaattttcatgaacaatccaagcataattgttaagaacacgtgtattaaattcatgtaagtggaataaaagttttatgaatggacttttcaactactttctctacagcttttcatgtaaattagtcttggttctgaaacttctctaaaggaaattgtacattttttgaaatttattccttattccctcttggcagctaatgggctcttaccaagtttaaacacaaaatttatcataacaaaaatactactaatataactactgtttccatgtcccatgatcccctctcttcctccccaccctgaaaaaaatgagttcctattttttctgggagagggggggattgattagaaaaaaatgtagtgtgttccatttaaaattttggcatatggcattttctaacttaggaagccacaatgttcttggcccatcatgacattgggtagcattaactgtaagttttgtgcttccaaatcactttttggtttttaagaatttcttgatactcttatagcctgccttcaattttgatcctttattctttctatttgtcaggtgcacaagattaccttcctgttttagccttctgtcttgtcaccaaccattcttacttggtggccatgtacttggaaaaaggccgcatgatctttctggctccactcagtgtctaaggcaccctgcttcctttgcttgcatcccacagactatttccctcatcctatttactgcagcaaatctctccttagttgatgagactgtgtttatctccctttaaaaccctacctatcctgaatggtctgtcattgtctgcctttaaaatccttcctctttcttcctcctctattctctaaataatgatggggctaagttatacccaaagctcactttacaaaatatttcctcagtactttgcagaaaacaccaaacaaaaatgccattttaaaaaaggtgtattttttcttttagaatgtaagctcctcaagagcagggacaatgttttctgtatgttctattgtgcctagtacactgtaaatgctcaataaatattgatgatgggaggcagtgagtcttgatgataagggtgagaaactgaaatcccaaacactgttttgttgcttgttttattatgacctcagattaaattgggaaatattggcccttttgaataattgtcccaaatattacattcaaataaaagtgcaatggagaaaaaaaaaaa

//

Annotations: