2024-04-18 12:16:41, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001135699 3020 bp mRNA linear PRI 01-JUL-2013 DEFINITION Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3, mRNA. ACCESSION NM_001135699 VERSION NM_001135699.1 GI:208973237 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3020) AUTHORS Riou,P., Kjaer,S., Garg,R., Purkiss,A., George,R., Cain,R.J., Bineva,G., Reymond,N., McColl,B., Thompson,A.J., O'Reilly,N., McDonald,N.Q., Parker,P.J. and Ridley,A.J. TITLE 14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif to inhibit G proteins JOURNAL Cell 153 (3), 640-653 (2013) PUBMED 23622247 REMARK GeneRIF: Study reports a high-affinity 14-3-3-binding site at the C terminus of Rnd3 consisting of both the Cys241-farnesyl moiety and a Rho-associated coiled coil containing protein kinase (ROCK)-dependent Ser240 phosphorylation site. REFERENCE 2 (bases 1 to 3020) AUTHORS Nishimura,Y., Komatsu,S., Ichikawa,D., Nagata,H., Hirajima,S., Takeshita,H., Kawaguchi,T., Arita,T., Konishi,H., Kashimoto,K., Shiozaki,A., Fujiwara,H., Okamoto,K., Tsuda,H. and Otsuji,E. TITLE Overexpression of YWHAZ relates to tumor cell proliferation and malignant outcome of gastric carcinoma JOURNAL Br. J. Cancer 108 (6), 1324-1331 (2013) PUBMED 23422756 REMARK GeneRIF: Overexpression of YWHAZ relates to tumor cell proliferation and malignant outcome of gastric carcinoma. REFERENCE 3 (bases 1 to 3020) AUTHORS Bergamaschi,A., Frasor,J., Borgen,K., Stanculescu,A., Johnson,P., Rowland,K., Wiley,E.L. and Katzenellenbogen,B.S. TITLE 14-3-3zeta as a predictor of early time to recurrence and distant metastasis in hormone receptor-positive and -negative breast cancers JOURNAL Breast Cancer Res. Treat. 137 (3), 689-696 (2013) PUBMED 23271328 REMARK GeneRIF: 14-3-3zeta as a predictor of early time to recurrence and distant metastasis in hormone receptor-positive and -negative breast cancers. REFERENCE 4 (bases 1 to 3020) AUTHORS Boon,S.S. and Banks,L. TITLE High-risk human papillomavirus E6 oncoproteins interact with 14-3-3zeta in a PDZ binding motif-dependent manner JOURNAL J. Virol. 87 (3), 1586-1595 (2013) PUBMED 23175360 REMARK GeneRIF: The interaction is direct and specific for the high-risk HPV E6 oncoproteins, although there are significant differences in the efficiencies with which HPV-16, HPV-18, and HPV-31 E6 oncoproteins can associate with 14-3-3zeta. REFERENCE 5 (bases 1 to 3020) AUTHORS Skwarczynska,M., Molzan,M. and Ottmann,C. TITLE Activation of NF-kappaB signalling by fusicoccin-induced dimerization JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (5), E377-E386 (2013) PUBMED 23269842 REMARK GeneRIF: Data indicate that fusicoccin (FC)-mediated dimerization of the NF-kappaB-C terminus(CT) with a constitutively nuclear-localized 14-3-3 protein led to an NF-kappaB-specific cellular response by inducing IL-8 secretion. REFERENCE 6 (bases 1 to 3020) AUTHORS Koyama,S., Williams,L.T. and Kikuchi,A. TITLE Characterization of the interaction of Raf-1 with ras p21 or 14-3-3 protein in intact cells JOURNAL FEBS Lett. 368 (2), 321-325 (1995) PUBMED 7628630 REFERENCE 7 (bases 1 to 3020) AUTHORS Liu,D., Bienkowska,J., Petosa,C., Collier,R.J., Fu,H. and Liddington,R. TITLE Crystal structure of the zeta isoform of the 14-3-3 protein JOURNAL Nature 376 (6536), 191-194 (1995) PUBMED 7603574 REFERENCE 8 (bases 1 to 3020) AUTHORS Sato,T., Irie,S., Kitada,S. and Reed,J.C. TITLE FAP-1: a protein tyrosine phosphatase that associates with Fas JOURNAL Science 268 (5209), 411-415 (1995) PUBMED 7536343 REFERENCE 9 (bases 1 to 3020) AUTHORS Kawamoto,S., Shoji,M., Setoguchi,Y., Kato,M., Hashizume,S., Ichikawa,A., Osada,K., Katakura,Y., Tachibana,H. and Murakami,H. TITLE Molecular cloning of the 31 kDa cytosolic phospholipase A2, as an antigen recognized by the lung cancer-specific human monoclonal antibody, AE6F4 JOURNAL Cytotechnology 17 (2), 103-108 (1995) PUBMED 7547034 REFERENCE 10 (bases 1 to 3020) AUTHORS Zupan,L.A., Steffens,D.L., Berry,C.A., Landt,M. and Gross,R.W. TITLE Cloning and expression of a human 14-3-3 protein mediating phospholipolysis. Identification of an arachidonoyl-enzyme intermediate during catalysis JOURNAL J. Biol. Chem. 267 (13), 8707-8710 (1992) PUBMED 1577711 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AA830489.1, BC072426.1 and BM783874.1. Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008]. Transcript Variant: This variant (3) differs in the 5' UTR compared to variant 2. All six transcripts encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK289945.1, BM550052.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-144 AA830489.1 1-144 145-2903 BC072426.1 97-2855 2904-3020 BM783874.1 221-337 FEATURES Location/Qualifiers source 1..3020 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="8" /map="8q23.1" gene 1..3020 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide" /db_xref="GeneID:7534" /db_xref="HGNC:12855" /db_xref="MIM:601288" exon 1..144 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" exon 145..449 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" CDS 156..893 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="14-3-3 delta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; 14-3-3 zeta; phospholipase A2; protein kinase C inhibitor protein-1; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; 14-3-3 protein/cytosolic phospholipase A2; protein kinase C inhibitor protein 1" /codon_start=1 /product="14-3-3 protein zeta/delta" /protein_id="NP_001129171.1" /db_xref="GI:208973238" /db_xref="CCDS:CCDS6290.1" /db_xref="GeneID:7534" /db_xref="HGNC:12855" /db_xref="MIM:601288" /translation="
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
" misc_feature 156..158 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="N-acetylmethionine; propagated from UniProtKB/Swiss-Prot (P63104.1); acetylation site" misc_feature 159..845 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="14-3-3 beta and zeta isoforms of 14-3-3 protein; Region: 14-3-3_beta_zeta; cd10022" /db_xref="CDD:206758" misc_feature 162..164 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P63104.1); acetylation site" misc_feature order(168..170,177..182,189..194,198..203,207..209, 216..218,327..329,336..338,348..350,378..380,387..392, 399..401,408..413,420..422) /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:206758" misc_feature order(276..281,288..293,300..302,504..506,513..515, 534..539,648..650,660..662,669..674,681..683,780..794, 801..806,813..815,825..827) /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /note="peptide binding site [polypeptide binding]; other site" /db_xref="CDD:206758" misc_feature 321..323 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="non-experimental evidence, no additional details recorded" /note="Interaction with phosphoserine on interacting protein (By similarity); propagated from UniProtKB/Swiss-Prot (P63104.1); other site" misc_feature 327..329 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by PKA and PKB/AKT1; propagated from UniProtKB/Swiss-Prot (P63104.1); phosphorylation site" misc_feature 357..359 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P63104.1); acetylation site" misc_feature 534..536 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="non-experimental evidence, no additional details recorded" /note="Interaction with phosphoserine on interacting protein (By similarity); propagated from UniProtKB/Swiss-Prot (P63104.1); other site" misc_feature 705..707 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by MAPK8; propagated from UniProtKB/Swiss-Prot (P63104.1); phosphorylation site" misc_feature 774..776 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P63104.1); phosphorylation site" misc_feature 849..851 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine, by CK1; propagated from UniProtKB/Swiss-Prot (P63104.1); phosphorylation site" STS 356..599 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /standard_name="PMC150726P7" /db_xref="UniSTS:271079" variation 382 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="g" /db_xref="dbSNP:11551365" variation 416 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="g" /db_xref="dbSNP:41473144" exon 450..573 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" exon 574..737 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" exon 738..833 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" exon 834..3010 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /inference="alignment:Splign:1.39.8" variation 979 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="g" /replace="t" /db_xref="dbSNP:11551354" STS 1162..1255 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /standard_name="PMC126239P3" /db_xref="UniSTS:270535" variation 1251 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="g" /replace="t" /db_xref="dbSNP:11551357" STS 1281..2029 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /standard_name="YWHAZ_1120.2" /db_xref="UniSTS:281082" variation 1360 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="c" /replace="t" /db_xref="dbSNP:11545396" polyA_signal 1866..1871 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" polyA_site 1897 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" variation 2380 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="c" /replace="t" /db_xref="dbSNP:11551356" variation 2665 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="c" /replace="g" /db_xref="dbSNP:1062376" variation 2685 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="c" /db_xref="dbSNP:1062382" variation 2811 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="c" /replace="t" /db_xref="dbSNP:1139382" variation 2827 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="c" /db_xref="dbSNP:1062393" polyA_signal 2840..2845 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" polyA_site 2863 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" polyA_site 2903 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" variation 2905 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" /replace="a" /replace="c" /db_xref="dbSNP:3203463" polyA_signal 2992..2997 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" polyA_site 3010 /gene="YWHAZ" /gene_synonym="14-3-3-zeta; KCIP-1; YWHAD" ORIGIN
tgtcccctcgcgcagtcaccgagcgcagatcccgcgctctcgattggaacgcctccccatcactcagccacactcaggggctggacgcctcactcccgtttccgagccataaaaggtctaggaccgcttcccccgagccagcagaacatccagtcatggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgatgacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggagaggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagggtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcgagaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctcttttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaaatgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaagggattgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatgcaaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgagattctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccattgctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaattactgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcaggagaaggaggggaaaattaaccggccttccaacttttgtctgcctcattctaaaatttacacagtagaccatttgtcatccatgctgtcccacaaatagttttttgtttacgatttatgacaggtttatgttacttctatttgaatttctatatttcccatgtggtttttatgtttaatattaggggagtagagccagttaacatttagggagttatctgttttcatcttgaggtggccaatatggggatgtggaatttttatacaagttataagtgtttggcatagtacttttggtacattgtggcttcaaaagggccagtgtaaaactgcttccatgtctaagcaaagaaaactgcctacatactggtttgtcctggcggggaataaaagggatcattggttccagtcacaggtgtagtaattgtgggtactttaaggtttggagcacttacaaggctgtggtagaatcataccccatggataccacatattaaaccatgtatatctgtggaatactcaatgtgtacacctttgactacagctgcagaagtgttcctttagacaaagttgtgacccattttactctggataagggcagaaacggttcacattccattatttgtaaagttacctgctgttagctttcattatttttgctacactcattttatttgtatttaaatgttttaggcaacctaagaacaaatgtaaaagtaaagatgcaggaaaaatgaattgcttggtattcattacttcatgtatatcaagcacagcagtaaaacaaaaacccatgtatttaacttttttttaggatttttgcttttgtgatttttttttttttgatacttgcctaacatgcatgtgctgtaaaaatagttaacagggaaataacttgagatgatggctagctttgtttaatgtcttatgaaattttcatgaacaatccaagcataattgttaagaacacgtgtattaaattcatgtaagtggaataaaagttttatgaatggacttttcaactactttctctacagcttttcatgtaaattagtcttggttctgaaacttctctaaaggaaattgtacattttttgaaatttattccttattccctcttggcagctaatgggctcttaccaagtttaaacacaaaatttatcataacaaaaatactactaatataactactgtttccatgtcccatgatcccctctcttcctccccaccctgaaaaaaatgagttcctattttttctgggagagggggggattgattagaaaaaaatgtagtgtgttccatttaaaattttggcatatggcattttctaacttaggaagccacaatgttcttggcccatcatgacattgggtagcattaactgtaagttttgtgcttccaaatcactttttggtttttaagaatttcttgatactcttatagcctgccttcaattttgatcctttattctttctatttgtcaggtgcacaagattaccttcctgttttagccttctgtcttgtcaccaaccattcttacttggtggccatgtacttggaaaaaggccgcatgatctttctggctccactcagtgtctaaggcaccctgcttcctttgcttgcatcccacagactatttccctcatcctatttactgcagcaaatctctccttagttgatgagactgtgtttatctccctttaaaaccctacctatcctgaatggtctgtcattgtctgcctttaaaatccttcctctttcttcctcctctattctctaaataatgatggggctaagttatacccaaagctcactttacaaaatatttcctcagtactttgcagaaaacaccaaacaaaaatgccattttaaaaaaggtgtattttttcttttagaatgtaagctcctcaagagcagggacaatgttttctgtatgttctattgtgcctagtacactgtaaatgctcaataaatattgatgatgggaggcagtgagtcttgatgataagggtgagaaactgaaatcccaaacactgttttgttgcttgttttattatgacctcagattaaattgggaaatattggcccttttgaataattgtcccaaatattacattcaaataaaagtgcaatggagaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:7534 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:7534 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IPI GeneID:7534 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI GeneID:7534 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IEA GeneID:7534 -> Molecular function: GO:0032403 [protein complex binding] evidence: IEA GeneID:7534 -> Biological process: GO:0002553 [histamine secretion by mast cell] evidence: IEA GeneID:7534 -> Biological process: GO:0006626 [protein targeting to mitochondrion] evidence: IEA GeneID:7534 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:7534 -> Biological process: GO:0007165 [signal transduction] evidence: TAS GeneID:7534 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS GeneID:7534 -> Biological process: GO:0010467 [gene expression] evidence: TAS GeneID:7534 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS GeneID:7534 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS GeneID:7534 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS GeneID:7534 -> Biological process: GO:0030168 [platelet activation] evidence: TAS GeneID:7534 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS GeneID:7534 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:7534 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS GeneID:7534 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:7534 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS GeneID:7534 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA GeneID:7534 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:7534 -> Cellular component: GO:0014069 [postsynaptic density] evidence: IEA GeneID:7534 -> Cellular component: GO:0030659 [cytoplasmic vesicle membrane] evidence: TAS GeneID:7534 -> Cellular component: GO:0031252 [cell leading edge] evidence: IEA GeneID:7534 -> Cellular component: GO:0042470 [melanosome] evidence: IEA GeneID:7534 -> Cellular component: GO:0043234 [protein complex] evidence: IEA GeneID:7534 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.