GGRNA Home | Help | Advanced search

2020-10-26 18:53:04, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001135586            5083 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens chromosome 5 open reading frame 24 (C5orf24),
            transcript variant 1, mRNA.
ACCESSION   NM_001135586
VERSION     NM_001135586.1  GI:207450710
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5083)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DA760705.1 and AC006077.1.
            
            Transcript Variant: This variant (1) represents the longer
            transcript. Variants 1 and 2 both encode the same protein.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data because no single transcript was available
            for the full length of the gene. The extent of this transcript is
            supported by transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DA760705.1, AK094881.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-153               DA760705.1         1-153
            154-172             DA760705.1         155-173
            173-570             DA760705.1         175-572
            571-5083            AC006077.1         22385-26897
FEATURES             Location/Qualifiers
     source          1..5083
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="5q31.1"
     gene            1..5083
                     /gene="C5orf24"
                     /note="chromosome 5 open reading frame 24"
                     /db_xref="GeneID:134553"
                     /db_xref="HGNC:26746"
     exon            1..245
                     /gene="C5orf24"
                     /inference="alignment:Splign:1.39.8"
     variation       7
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367568912"
     variation       118
                     /gene="C5orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:184599692"
     misc_feature    210..212
                     /gene="C5orf24"
                     /note="upstream in-frame stop codon"
     variation       234
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150880564"
     exon            246..5083
                     /gene="C5orf24"
                     /inference="alignment:Splign:1.39.8"
     CDS             249..815
                     /gene="C5orf24"
                     /codon_start=1
                     /product="UPF0461 protein C5orf24"
                     /protein_id="NP_001129058.1"
                     /db_xref="GI:207450711"
                     /db_xref="CCDS:CCDS4179.1"
                     /db_xref="GeneID:134553"
                     /db_xref="HGNC:26746"
                     /translation="
MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE
"
     misc_feature    357..359
                     /gene="C5orf24"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q7Z6I8.1); phosphorylation site"
     variation       256
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182827108"
     variation       324
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144977700"
     variation       371
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368441862"
     variation       373
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:76797142"
     variation       375
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372418986"
     variation       385
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373302777"
     variation       390
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189210384"
     variation       437
                     /gene="C5orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376967674"
     variation       455
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138898204"
     variation       507
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142019018"
     variation       530
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146323904"
     prim_transcript join(<571..593,1093..1300)
                     /gene="C5orf24"
                     /standard_name="za86e05"
                     /note="99% entity EST dbEST:N76126"
     prim_transcript <571..786
                     /gene="C5orf24"
                     /standard_name="vr48g07"
                     /note="91% entity mouse EST dbEST:AA794927"
     variation       576
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368128995"
     variation       624
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148188988"
     variation       650
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141164760"
     variation       665
                     /gene="C5orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:193092391"
     variation       678
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375925184"
     variation       696
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199887798"
     variation       747
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369059533"
     variation       765
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150693644"
     variation       768
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139980444"
     variation       772
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150797739"
     variation       779
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145067433"
     variation       800
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75692562"
     variation       808
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140427240"
     variation       857
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368013222"
     variation       862
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371433307"
     variation       868
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139222825"
     variation       870
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143589903"
     variation       878
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184484229"
     variation       1094
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147194284"
     variation       1112
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187459204"
     variation       1140
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191834107"
     variation       1275..1280
                     /gene="C5orf24"
                     /replace=""
                     /replace="gtaaca"
                     /db_xref="dbSNP:368150166"
     variation       1275
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202016249"
     variation       1351
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184054742"
     variation       1513
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376746765"
     variation       1567
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113314814"
     variation       1636
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188596864"
     variation       1926
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112436387"
     variation       1989..2000
                     /gene="C5orf24"
                     /replace=""
                     /replace="aaataaataaat"
                     /db_xref="dbSNP:144902250"
     variation       1989..1992
                     /gene="C5orf24"
                     /replace=""
                     /replace="aaat"
                     /db_xref="dbSNP:202226698"
     variation       2000..2003
                     /gene="C5orf24"
                     /replace=""
                     /replace="taaa"
                     /db_xref="dbSNP:10552008"
     variation       2022
                     /gene="C5orf24"
                     /replace=""
                     /replace="ataa"
                     /db_xref="dbSNP:72322633"
     variation       2028
                     /gene="C5orf24"
                     /replace=""
                     /replace="taaa"
                     /db_xref="dbSNP:61626616"
     variation       2031
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181710725"
     variation       2094
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185140929"
     variation       2128
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112492801"
     variation       2142
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190830022"
     variation       2191
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181935929"
     variation       2319
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144737830"
     variation       2346
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186132693"
     variation       2701
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:78987868"
     misc_feature    2705..2779
                     /gene="C5orf24"
                     /note="GRAIL 2 excellent exon, frame 2"
     variation       2720
                     /gene="C5orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373114001"
     variation       2797
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377231492"
     variation       2822
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115396590"
     variation       2845
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145780106"
     variation       2981
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114887018"
     prim_transcript 3077..3664
                     /gene="C5orf24"
                     /standard_name="af70g12"
                     /note="99% entity EST dbEST:AA625228"
     variation       3132
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:148502660"
     variation       3142
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116661206"
     variation       3206
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:189595352"
     variation       3368
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180750598"
     variation       3396
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367598207"
     variation       3470
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80346634"
     variation       3479
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:118050206"
     variation       3566
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374934904"
     variation       3620
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:185600585"
     variation       3753
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190060727"
     variation       4010
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113157441"
     variation       4107
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151105359"
     STS             4142..4311
                     /gene="C5orf24"
                     /standard_name="SHGC-64770"
                     /db_xref="UniSTS:184206"
     variation       4210
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:15236"
     variation       4216
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112372759"
     variation       4271
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17695346"
     variation       4323
                     /gene="C5orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145093735"
     variation       4427
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:4418145"
     variation       4428
                     /gene="C5orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371291842"
     variation       4490
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:5028926"
     variation       4492
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:5028927"
     variation       4495
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:5028928"
     variation       4506
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:62380022"
     variation       4508
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:140681325"
     variation       4511
                     /gene="C5orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:5028929"
     STS             4805..4946
                     /gene="C5orf24"
                     /standard_name="A007F30"
                     /db_xref="UniSTS:63148"
     variation       4857
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11553310"
     STS             4861..4986
                     /gene="C5orf24"
                     /standard_name="RH47430"
                     /db_xref="UniSTS:24779"
     variation       4891
                     /gene="C5orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3200480"
     variation       4895
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144649531"
     variation       4967
                     /gene="C5orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35694512"
     variation       4982
                     /gene="C5orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:11553311"
ORIGIN      
aacactacagggtggtagcggcctcttcgtactgcgtccggggcaggaccgtgcgcggcggccgcggcgggtgctgggagccagcgcctgcctcgccgccgccctcgctgcctgccactccgtcttggcccgttctccgcaccgtgcagaggcggcgggctggggagggagcggcgccagcacgaggttcccagccgctgggaagcccctagacgcgccgaggggccgggctacgagcggctgagaaaatgatgcatcctgttgccagcagtaatccagctttctgtgggcctggcaagccttcctgcctcaatgaagatgccatgagagctgctgatcagtttgacatatattcctcccagcaaagcaaatacagccacacagtcaaccacaaaccaatggtttgtcagaggcaagacccattaaatgaaacacacttgcagactacaagtggcagaagcatagaaataaaagatgaactaaagaaaaagaagaatctcaaccgatctggtaagcgtggccggccttcgggaaccaccaaatcagcaggataccggaccagcacaggcagacccctgggaaccaccaaagcagctggatttaagacaagtccaggcagacctttggggacaactaaagctgcgggatacaaagtcagcccaggcagacctccaggtagcattaaagctctatcccgtcttgccgatcttggttatggctgtggcactgctgcttttccttaccctatgatgcatggcagagcagttcatggggtagaggaaactagcagtgaagtcaaaccacccaatgagtgaatgaggcaggaaaagagggccaggtttagaaggaagattgtgaataatcccaaagcttcttggttttattttgatatacataattttatggcctgggctttccaaatttgttttcctgtttggtttttttcctgcttttgctcaaaaactgccatatgctgacagatgcactcagggcatgagcagcggcattgtatttgtacataggttcaagtgtaacacctaactaaatcatttttccttttcctttagagttatggtcatgtctcatgtttcattactactttggggctgttctaaatagatgctttatgtgataaacaactgaaaccattatacctattagtttgtgaagtaagcctacagtataataaagacactaacgtatttttaactgatggagcaaaaaagcaaactaatgaatcaggattacttgaggtaatggctgtgtgagtttttgtaacatttattttcacaagatgggacacatatttgtatgctttggcatttacatccacttcaaatgttaaaaaacttatttttaatgttttaggtttaagcagcttgtaatttattgatctacatggcattaattgatttaaccattatacctgaaataattcttcagtgtttgcctttgagcagtgataggttgtgtattttttaattgcctaagagcatatataccaaacactacaaacaattcatatttacagaaaatttaaactattttataaaaactgcacattacatttttggtgaaatatagtgcattctgaggatagcatatttcatataatagaaaaagaagcattctctaggtttgcatgtagctatagtcactatattttgcctttcatatagaaagttttaaagtattatgtttaaaaacatttattggctgggtgtggtggctcacacccagcactttgggaggccgaggcaggcggatcacttgaggtcagcagttcaagactagcctggccaacatggtgaaaccccatctctactaaaaatataaaaattagccaggcgtggtggcgggcgcctgtaatccaagctactggggaggctgaggcaggagaattgcttaaatccaggaggcggaggttgcagtgagccaagattgtgccactgcactccagcctgggtgacagagtaagactccgtctcaaataaataaataaataaataaataaataaataaataaataaaaccatttattgatgttgctcatttatttggaacgtttttagtttttctcagaaattgtcccattgcattagcacttactgtgttttcaggttgatatctaccaaaggacacaaattgaatggtagactgtaaaactggtataaacagaatgcagtttcccgaccatcagaacccaaatattaagaagcatataggaatccatctatgcatgaaacatgtaaaaaatatgttggttagtttaattaaaaatcttattgtgggtccagtgagaccatctcatccaaaagattttttttcccccaatgatgtttgctttagaagcaagatagaaaggaaaaaaagtattaggtagatatgtatagtagggacagagggaaatctttcttctttcctttctgaaagtaatacttcttgttacacattttatttattgagtttgttctaaataaaatattataaacttcagacttgaaaaaattccacttaactttaaagttacaatgtttgtatttgggattttaaatgcctttgagattaaaatgtagaattgcaggacccaaaaacttttaaaataattaaaattttaaaagagcacatgttgtgttttttgggcttgctattaatgcaaactctgattgcaaatggatgtcatgtttcataccttttttatcaggaaaaaagcagcaagccttcaggtgttccagtgatgcctgacacaattgagctggactttatgctgctctttacagtaagaggtgttgcattgtatgtggggactatgtgcactggcgtctaagacagtgacctcaacaatattagctttgcacaaaccatagagaacgatgttggatggttacataatcagttataacattctggcagctaaattgctacaagagctttttcttgcaaaagcttaaaatacaagatttttaataatttactcagaacagtataacttctgacacacacaaatgcttgcctctttattcatatgttcgttacctactctgtacatgtatctgtcatttagctgtttctcaagatgatgttcagcagttggctgcttagaaatctttttcaagccagtttctaaagacatttgtttaatgttctaccatagaataatgcacaccattgtcaaagatttgattattgtgttttatagtaagtccatttgacatttatttccctttcagtttattttccttccttattttgttatacatacccttccctttctcccctgcctttcgtacattcattcctcttcctctaccctccagcacatctacttactggtgctgtgctgtgtgtcagaagataaaacaggtgtattattgtataatgaattttgtatacatgtttatgaaatggtgagatcaactaaaggaggcatgttcataacagtgtttattatcagcagctatgtcccaggaaaaaaaaatgggaggggcaaatggctacagttgtaaatggataacatcatttagaaagccgaatttactgttcatctgagcggttacctggagtattatatctatgcactggtgagcatctcctgattccacttacttttctccctgtgaacagtttaccggtgccatgctgaagagaaagacatctaagtgataacatgaatgaagtcttaaaatttaaagtatttttactgctatataaactaaagactacattgtgcatattttgttaacactgtctcttgttatgataaacactgaaatagcatgttaaacagttgcctatactttaatataatcagttggggaaaactggccttttctcccccactgtatgattgtttcttgaaaggtaaattgctaattttatacagtgtaattctgttcttcacaaaataggtttcattattctatatttaaactgttggtcagaaaatgatctgcaattcaagtaagtctgcattacttttttctttaaaaagtactttaacatgccttatttattatattagcaaatgagctaataacagatgaaattttcattttttgacagatataaccttgcataagtagtatttagggtgattttgatactatctttagagttttgcattggatattaaaaaatatattggcacaatgtattggaagaaaatgagtagtatctggtttaatttttaatatttagggacattttaaaaaatcaatgttttaattagactaaaaattctttatattttttatttactttttaaagaaacatctgtcaaagtaatattgattccaaactgatgtttgtgtgaatttacatgtctattttcatgaactaagaatagagtttctttgagttgaggagaaaaaaatatatatgtgggtccatttattaggttaaagttgacccattcagtgtaaaaataaccatagtgtgtgagctaaagaaaaaaaaaagtaaatttctcctttatattctaagaagctttaaaagaacaattcaggggttattgataactgctactctgtcggtcattgtctctatatgcagtaaaattttatggtccctttataggaatataaagaattcaaaacagtttttcaaaagatttttttccttggacataaaaaattttgatgctattctatttttgtttttattacagcttaactgtatgctgttaaactctaggatgtatctgaatctttccttttttcccccctcctccaaatatataaatctgtgctctcacatgtaatgtatttaatttttggaaaatttaatgctatatagtaaatcaagtgtgtgatttaaagtaatcagatcactttgattcttttaagttttcagaatttcttttttccacaggtaattttggagaaaataattaccaattaactgataataagcacgctgtcctctgctgtaaaaagtctgaatagatactgtgtatgtttttatgtccatgaacttgagctactcgtgtgcaattatgtgtatgggaatggagtagtgttcatgatttgtatctacatcatcatatggatgtatatttattaataaagtcattactttaaaacca
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.