Home |
Help |
Advanced search
2024-04-25 07:05:36, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001130688 1467 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens high mobility group box 2 (HMGB2), transcript variant
2, mRNA.
ACCESSION NM_001130688
VERSION NM_001130688.1 GI:194688132
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1467)
AUTHORS McCauley,M.J., Rueter,E.M., Rouzina,I., Maher,L.J. III and
Williams,M.C.
TITLE Single-molecule kinetics reveal microscopic mechanism by which
High-Mobility Group B proteins alter DNA flexibility
JOURNAL Nucleic Acids Res. 41 (1), 167-181 (2013)
PUBMED 23143110
REMARK GeneRIF: Transient local HMGB2-DNA contacts dominate the
DNA-bending mechanism used by HMGB proteins to increase DNA
flexibility.
REFERENCE 2 (bases 1 to 1467)
AUTHORS Takaishi,H., Kanai,T., Nakazawa,A., Sugata,F., Nikai,A.,
Yoshizawa,S., Hamamoto,Y., Funakoshi,S., Yajima,T., Iwao,Y.,
Takemura,M., Ozaki,S. and Hibi,T.
TITLE Anti-high mobility group box 1 and box 2 non-histone chromosomal
proteins (HMGB1/HMGB2) antibodies and anti-Saccharomyces cerevisiae
antibodies (ASCA): accuracy in differentially diagnosing UC and CD
and correlation with inflammatory bowel disease phenotype
JOURNAL J. Gastroenterol. 47 (9), 969-977 (2012)
PUBMED 22644337
REMARK GeneRIF: Crohn's disease in the colon and ulcerative colitis can be
differentially diagnosed using anti-HMGB/HMGB2 antibodies combined
with anti-Saccharomyces cerevisiae antibodies.
REFERENCE 3 (bases 1 to 1467)
AUTHORS Taniguchi,N., Carames,B., Hsu,E., Cherqui,S., Kawakami,Y. and
Lotz,M.
TITLE Expression patterns and function of chromatin protein HMGB2 during
mesenchymal stem cell differentiation
JOURNAL J. Biol. Chem. 286 (48), 41489-41498 (2011)
PUBMED 21890638
REMARK GeneRIF: The age-related loss of HMGB2 in articular cartilage may
represent a mechanism responsible for the decline in adult
cartilage stem cell populations.
REFERENCE 4 (bases 1 to 1467)
AUTHORS Kwon,J.H., Kim,J., Park,J.Y., Hong,S.M., Park,C.W., Hong,S.J.,
Park,S.Y., Choi,Y.J., Do,I.G., Joh,J.W., Kim,D.S. and Choi,K.Y.
TITLE Overexpression of high-mobility group box 2 is associated with
tumor aggressiveness and prognosis of hepatocellular carcinoma
JOURNAL Clin. Cancer Res. 16 (22), 5511-5521 (2010)
PUBMED 20851854
REMARK GeneRIF: The results can partly be explained by altered cell
proliferations by HMGB2 associated with the antiapoptotic pathway.
REFERENCE 5 (bases 1 to 1467)
AUTHORS Lee,D., Kwon,J.H., Kim,E.H., Kim,E.S. and Choi,K.Y.
TITLE HMGB2 stabilizes p53 by interfering with E6/E6AP-mediated p53
degradation in human papillomavirus-positive HeLa cells
JOURNAL Cancer Lett. 292 (1), 125-132 (2010)
PUBMED 20036050
REMARK GeneRIF: Our findings collectively suggest that HMGB2 could
stabilize p53 by interfering with E6/E6AP-mediated p53 degradation
in HPV-positive HeLa cells.
REFERENCE 6 (bases 1 to 1467)
AUTHORS Alexandre,S., Li,W.W. and Lee,A.S.
TITLE A human HMG2 cDNA with a novel 3'-untranslated region
JOURNAL Nucleic Acids Res. 20 (23), 6413 (1992)
PUBMED 1475204
REFERENCE 7 (bases 1 to 1467)
AUTHORS Shirakawa,H. and Yoshida,M.
TITLE Structure of a gene coding for human HMG2 protein
JOURNAL J. Biol. Chem. 267 (10), 6641-6645 (1992)
PUBMED 1551873
REFERENCE 8 (bases 1 to 1467)
AUTHORS Majumdar,A., Brown,D., Kerby,S., Rudzinski,I., Polte,T.,
Randhawa,Z. and Seidman,M.M.
TITLE Sequence of human HMG2 cDNA
JOURNAL Nucleic Acids Res. 19 (23), 6643 (1991)
PUBMED 1754403
REFERENCE 9 (bases 1 to 1467)
AUTHORS Bernues,J., Espel,E. and Querol,E.
TITLE Identification of the core-histone-binding domains of HMG1 and HMG2
JOURNAL Biochim. Biophys. Acta 866 (4), 242-251 (1986)
PUBMED 3697355
REFERENCE 10 (bases 1 to 1467)
AUTHORS Chiou,W.L. and Niazi,S.
TITLE Pharmaceutical applications of solid dispersion systems:
dissolution of griseofulvin-succinic acid eutectic mixture
JOURNAL J Pharm Sci 65 (8), 1212-1214 (1976)
PUBMED 978439
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AK311864.1, BM727941.1 and
AA576809.1.
Summary: This gene encodes a member of the non-histone chromosomal
high mobility group protein family. The proteins of this family are
chromatin-associated and ubiquitously distributed in the nucleus of
higher eukaryotic cells. In vitro studies have demonstrated that
this protein is able to efficiently bend DNA and form DNA circles.
These studies suggest a role in facilitating cooperative
interactions between cis-acting proteins by promoting DNA
flexibility. This protein was also reported to be involved in the
final ligation step in DNA end-joining processes of DNA
double-strand breaks repair and V(D)J recombination. [provided by
RefSeq, Jul 2008].
Transcript Variant: This variant (2) differs in the 5' UTR,
compared to variant 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BU540073.1, BC100019.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-763 AK311864.1 1-763
764-1208 BM727941.1 114-558
1209-1467 AA576809.1 190-448
FEATURES Location/Qualifiers
source 1..1467
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="4"
/map="4q31"
gene 1..1467
/gene="HMGB2"
/gene_synonym="HMG2"
/note="high mobility group box 2"
/db_xref="GeneID:3148"
/db_xref="HGNC:5000"
/db_xref="MIM:163906"
exon 1..113
/gene="HMGB2"
/gene_synonym="HMG2"
/inference="alignment:Splign:1.39.8"
misc_feature 68..70
/gene="HMGB2"
/gene_synonym="HMG2"
/note="upstream in-frame stop codon"
exon 114..283
/gene="HMGB2"
/gene_synonym="HMG2"
/inference="alignment:Splign:1.39.8"
CDS 134..763
/gene="HMGB2"
/gene_synonym="HMG2"
/note="high-mobility group (nonhistone chromosomal)
protein 2; high-mobility group box 2; HMG-2; high mobility
group protein 2"
/codon_start=1
/product="high mobility group protein B2"
/protein_id="NP_001124160.1"
/db_xref="GI:194688133"
/db_xref="CCDS:CCDS3816.1"
/db_xref="GeneID:3148"
/db_xref="HGNC:5000"
/db_xref="MIM:163906"
/translation="
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
"
misc_feature 158..361
/gene="HMGB2"
/gene_synonym="HMG2"
/note="HMGB-UBF_HMG-box, class II and III members of the
HMG-box superfamily of DNA-binding proteins. These
proteins bind the minor groove of DNA in a non-sequence
specific fashion and contain two or more tandem HMG boxes.
Class II members include non-histone...; Region:
HMGB-UBF_HMG-box; cd01390"
/db_xref="CDD:238686"
misc_feature order(164..166,170..175,179..184,191..196,203..205,
215..217,260..262,269..271,278..280,335..337)
/gene="HMGB2"
/gene_synonym="HMG2"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:238686"
misc_feature 221..223
/gene="HMGB2"
/gene_synonym="HMG2"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P26583.2); acetylation site"
misc_feature 416..613
/gene="HMGB2"
/gene_synonym="HMG2"
/note="High Mobility Group (HMG)-box is found in a variety
of eukaryotic chromosomal proteins and transcription
factors. HMGs bind to the minor groove of DNA and have
been classified by DNA binding preferences. Two
phylogenically distinct groups of Class I...; Region:
HMG-box; cd00084"
/db_xref="CDD:238037"
misc_feature order(422..424,428..433,437..442,449..454,461..463,
473..475,512..514,521..523,530..532,587..589)
/gene="HMGB2"
/gene_synonym="HMG2"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:238037"
variation 276
/gene="HMGB2"
/gene_synonym="HMG2"
/replace="g"
/replace="t"
/db_xref="dbSNP:11542247"
exon 284..429
/gene="HMGB2"
/gene_synonym="HMG2"
/inference="alignment:Splign:1.39.8"
STS 404..512
/gene="HMGB2"
/gene_synonym="HMG2"
/standard_name="HMGB2"
/db_xref="UniSTS:503325"
exon 430..604
/gene="HMGB2"
/gene_synonym="HMG2"
/inference="alignment:Splign:1.39.8"
STS 533..672
/gene="HMGB2"
/gene_synonym="HMG2"
/standard_name="PMC170950P6"
/db_xref="UniSTS:271624"
exon 605..1467
/gene="HMGB2"
/gene_synonym="HMG2"
/inference="alignment:Splign:1.39.8"
STS 672..879
/gene="HMGB2"
/gene_synonym="HMG2"
/standard_name="RH126943"
/db_xref="UniSTS:209768"
STS 684..1248
/gene="HMGB2"
/gene_synonym="HMG2"
/standard_name="HMGB2_3099"
/db_xref="UniSTS:462899"
STS 765..1109
/gene="HMGB2"
/gene_synonym="HMG2"
/standard_name="SHGC-12669"
/db_xref="UniSTS:73475"
STS 766..857
/gene="HMGB2"
/gene_synonym="HMG2"
/standard_name="SHGC-67901"
/db_xref="UniSTS:49708"
polyA_signal 1124..1129
/gene="HMGB2"
/gene_synonym="HMG2"
polyA_site 1142
/gene="HMGB2"
/gene_synonym="HMG2"
ORIGIN
aaaccagttcacgccggagccccgtgagggaagcgtctccgttgggtccggccgctctgcgggactctgaggaaaagctcgcaccaggcaagaataccctccaataccctcgggtggacgcggatctgtcaacatgggtaaaggagaccccaacaagccgcggggcaaaatgtcctcgtacgccttcttcgtgcagacctgccgggaagagcacaagaagaaacacccggactcttccgtcaatttcgcggaattctccaagaagtgttcggagagatggaagaccatgtctgcaaaggagaagtcgaagtttgaagatatggcaaaaagtgacaaagctcgctatgacagggagatgaaaaattacgttcctcccaaaggtgataagaaggggaagaaaaaggaccccaatgctcctaaaaggccaccatctgccttcttcctgttttgctctgaacatcgcccaaagatcaaaagtgaacaccctggcctatccattggggatactgcaaagaaattgggtgaaatgtggtctgagcagtcagccaaagataaacaaccatatgaacagaaagcagctaagctaaaggagaaatatgaaaaggatattgctgcatatcgtgccaagggcaaaagtgaagcaggaaagaagggccctggcaggccaacaggctcaaagaagaagaacgaaccagaagatgaggaggaggaggaggaagaagaagatgaagatgaggaggaagaggatgaagatgaagaataaatggctatcctttaatgatgcgtgtggaatgtgtgtgtgtgctcaggcaattattttgctaagaatgtgaattcaagtgcagctcaatactagcttcagtataaaaactgtacagatttttgtatagctgataagattctctgtagagaaaatacttttaaaaaatgcaggttgtagctttttgatgggctactcatacagttagattttacagcttctgatgttgaatgttcctaaatatttaatggtttttttaatttcttgtgtatggtagcacagcaaacttgtaggaattagtatcaatagtaaattttgggttttttaggatgttgcatttcgtttttttaaaaaaaattttgtaataaaattatgtatattatttctattgtctttgtcttaatatgctaagttaattttcactttaaaaaagccatttgaagaccagagctatgttgatttttttcggtatttctgcctagtagttcttagacacagttgacctagtaaaatgtttgagaattaaaaccaaacatgctcatatttgcaaaatgttctttaaaagttacatgttgaactcagtgaactttataagaatttatgcagttttacagaacgttaagttttgtacttgacgtttctgtttattagctaaattgttcctcaggtgtgtgtatatatatatacatatatatatatatatatat
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3148 -> Molecular function: GO:0003677 [DNA binding] evidence: IMP
GeneID:3148 -> Molecular function: GO:0003684 [damaged DNA binding] evidence: IDA
GeneID:3148 -> Molecular function: GO:0003690 [double-stranded DNA binding] evidence: ISS
GeneID:3148 -> Molecular function: GO:0003697 [single-stranded DNA binding] evidence: ISS
GeneID:3148 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IDA
GeneID:3148 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:3148 -> Molecular function: GO:0008301 [DNA binding, bending] evidence: IDA
GeneID:3148 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IEA
GeneID:3148 -> Molecular function: GO:0042056 [chemoattractant activity] evidence: IDA
GeneID:3148 -> Molecular function: GO:0044212 [transcription regulatory region DNA binding] evidence: IDA
GeneID:3148 -> Molecular function: GO:0050786 [RAGE receptor binding] evidence: IGI
GeneID:3148 -> Biological process: GO:0001938 [positive regulation of endothelial cell proliferation] evidence: IDA
GeneID:3148 -> Biological process: GO:0006265 [DNA topological change] evidence: ISS
GeneID:3148 -> Biological process: GO:0006288 [base-excision repair, DNA ligation] evidence: IDA
GeneID:3148 -> Biological process: GO:0006309 [apoptotic DNA fragmentation] evidence: TAS
GeneID:3148 -> Biological process: GO:0006325 [chromatin organization] evidence: NAS
GeneID:3148 -> Biological process: GO:0006334 [nucleosome assembly] evidence: NAS
GeneID:3148 -> Biological process: GO:0006357 [regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:3148 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:3148 -> Biological process: GO:0006921 [cellular component disassembly involved in execution phase of apoptosis] evidence: TAS
GeneID:3148 -> Biological process: GO:0007289 [spermatid nucleus differentiation] evidence: IEA
GeneID:3148 -> Biological process: GO:0008584 [male gonad development] evidence: IEA
GeneID:3148 -> Biological process: GO:0032075 [positive regulation of nuclease activity] evidence: IDA
GeneID:3148 -> Biological process: GO:0033151 [V(D)J recombination] evidence: ISS
GeneID:3148 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA
GeneID:3148 -> Biological process: GO:0043388 [positive regulation of DNA binding] evidence: IDA
GeneID:3148 -> Biological process: GO:0045648 [positive regulation of erythrocyte differentiation] evidence: IMP
GeneID:3148 -> Biological process: GO:0045654 [positive regulation of megakaryocyte differentiation] evidence: IMP
GeneID:3148 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IDA
GeneID:3148 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IDA
GeneID:3148 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:3148 -> Biological process: GO:0048015 [phosphatidylinositol-mediated signaling] evidence: NAS
GeneID:3148 -> Biological process: GO:0048545 [response to steroid hormone stimulus] evidence: IEA
GeneID:3148 -> Biological process: GO:0050918 [positive chemotaxis] evidence: IDA
GeneID:3148 -> Biological process: GO:0051103 [DNA ligation involved in DNA repair] evidence: ISS
GeneID:3148 -> Biological process: GO:0060326 [cell chemotaxis] evidence: IDA
GeneID:3148 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IEP
GeneID:3148 -> Cellular component: GO:0000793 [condensed chromosome] evidence: IDA
GeneID:3148 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
GeneID:3148 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:3148 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:3148 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:3148 -> Cellular component: GO:0043234 [protein complex] evidence: IDA
GeneID:3148 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.