GGRNA Home | Help | Advanced search

2019-03-25 14:15:01, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001128127            4572 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens glycerol kinase (GK), transcript variant 3, mRNA.
ACCESSION   NM_001128127
VERSION     NM_001128127.2  GI:326381121
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4572)
  AUTHORS   Ramanjam,V., Delport,S. and Wilmshurst,J.M.
  TITLE     The diagnostic difficulties of complex glycerol kinase deficiency
  JOURNAL   J. Child Neurol. 25 (10), 1269-1271 (2010)
   PUBMED   20110216
  REMARK    GeneRIF: Two siblings with the contiguous X-linked gene deletion
            syndrome, complex glycerol kinase deficiency, are described. The
            elder sibling demonstrates the difficulties diagnosing this rare
            condition.
REFERENCE   2  (bases 1 to 4572)
  AUTHORS   Lu,Y., Dolle,M.E., Imholz,S., van 't Slot,R., Verschuren,W.M.,
            Wijmenga,C., Feskens,E.J. and Boer,J.M.
  TITLE     Multiple genetic variants along candidate pathways influence plasma
            high-density lipoprotein cholesterol concentrations
  JOURNAL   J. Lipid Res. 49 (12), 2582-2589 (2008)
   PUBMED   18660489
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (bases 1 to 4572)
  AUTHORS   Zhang,Y.H., Huang,B.L., Jialal,I., Northrup,H., McCabe,E.R. and
            Dipple,K.M.
  TITLE     Asymptomatic isolated human glycerol kinase deficiency associated
            with splice-site mutations and nonsense-mediated decay of mutant
            RNA
  JOURNAL   Pediatr. Res. 59 (4 PT 1), 590-592 (2006)
   PUBMED   16549535
  REMARK    GeneRIF: Results suggest that influences on RNA processing and
            protein stability represent modifiers of the glycerol kinase
            deficiency phenotype.
REFERENCE   4  (bases 1 to 4572)
  AUTHORS   Ohira,R.H., Dipple,K.M., Zhang,Y.H. and McCabe,E.R.
  TITLE     Human and murine glycerol kinase: influence of exon 18 alternative
            splicing on function
  JOURNAL   Biochem. Biophys. Res. Commun. 331 (1), 239-246 (2005)
   PUBMED   15845384
  REMARK    GeneRIF: Comparison of expression patterns, as well as enzymatic
            characteristics and subcellular localization of alternatively
            spliced glycerol kinase isoforms.
REFERENCE   5  (bases 1 to 4572)
  AUTHORS   Stepanian,S.V., Huyn,S.T., McCabe,E.R. and Dipple,K.M.
  TITLE     Characterization of the human glycerol kinase promoter:
            identification of a functional HNF-4alpha binding site and evidence
            for transcriptional activation
  JOURNAL   Mol. Genet. Metab. 80 (4), 412-418 (2003)
   PUBMED   14654354
  REMARK    GeneRIF: a functional HNF-4alpha binding site in the first 500 bp
            of the 5(') upstream region is important for increased levels of
            glycerol kinase expression
REFERENCE   6  (bases 1 to 4572)
  AUTHORS   Sargent,C.A., Young,C., Marsh,S., Ferguson-Smith,M.A. and
            Affara,N.A.
  TITLE     The glycerol kinase gene family: structure of the Xp gene, and
            related intronless retroposons
  JOURNAL   Hum. Mol. Genet. 3 (8), 1317-1324 (1994)
   PUBMED   7987308
REFERENCE   7  (bases 1 to 4572)
  AUTHORS   Guo,W., Worley,K., Adams,V., Mason,J., Sylvester-Jackson,D.,
            Zhang,Y.H., Towbin,J.A., Fogt,D.D., Madu,S., Wheeler,D.A. et al.
  TITLE     Genomic scanning for expressed sequences in Xp21 identifies the
            glycerol kinase gene
  JOURNAL   Nat. Genet. 4 (4), 367-372 (1993)
   PUBMED   8401584
REFERENCE   8  (bases 1 to 4572)
  AUTHORS   Love,D.R., Bloomfield,J.F., Kenwrick,S.J., Yates,J.R. and
            Davies,K.E.
  TITLE     Physical mapping distal to the DMD locus
  JOURNAL   Genomics 8 (1), 106-112 (1990)
   PUBMED   2081587
REFERENCE   9  (bases 1 to 4572)
  AUTHORS   Pillers,D.A., Weleber,R.G., Powell,B.R., Hanna,C.E., Magenis,R.E.
            and Buist,N.R.
  TITLE     Aland Island eye disease (Forsius-Eriksson ocular albinism) and an
            Xp21 deletion in a patient with Duchenne muscular dystrophy,
            glycerol kinase deficiency, and congenital adrenal hypoplasia
  JOURNAL   Am. J. Med. Genet. 36 (1), 23-28 (1990)
   PUBMED   2159212
REFERENCE   10 (bases 1 to 4572)
  AUTHORS   Kaneko,M., Kurokawa,M. and Ishibashi,S.
  TITLE     Binding and function of mitochondrial glycerol kinase in comparison
            with those of mitochondrial hexokinase
  JOURNAL   Arch. Biochem. Biophys. 237 (1), 135-141 (1985)
   PUBMED   2982325
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC042421.1, AK313215.1,
            AK294938.1, AA689298.1, AC112496.2 and AW300142.1.
            On Mar 18, 2011 this sequence version replaced gi:189409119.
            
            Summary: The protein encoded by this gene belongs to the FGGY
            kinase family. This protein is a key enzyme in the regulation of
            glycerol uptake and metabolism. It catalyzes the phosphorylation of
            glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations
            in this gene are associated with glycerol kinase deficiency (GKD).
            Alternatively spliced transcript variants encoding different
            isoforms have been found for this gene. [provided by RefSeq, Mar
            2011].
            
            Transcript Variant: This variant (3) lacks an in-frame coding exon
            in the mid-region, and contains an additional in-frame coding exon
            at the 3' end compared to variant 1. This results in a longer
            isoform (c) compared to isoform a.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns ERS025084,
                              ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-415               BC042421.1         2-416
            416-908             AK313215.1         352-844
            909-1743            BC042421.1         928-1762
            1744-2179           AK294938.1         1797-2232
            2180-3261           BC042421.1         2111-3192
            3262-3707           AA689298.1         23-468              c
            3708-4539           AC112496.2         126492-127323       c
            4540-4572           AW300142.1         1-33                c
FEATURES             Location/Qualifiers
     source          1..4572
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /map="Xp21.3"
     gene            1..4572
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="glycerol kinase"
                     /db_xref="GeneID:2710"
                     /db_xref="HGNC:4289"
                     /db_xref="MIM:300474"
     exon            1..257
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    18..20
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="upstream in-frame stop codon"
     variation       33
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112897079"
     variation       34
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113093297"
     variation       61
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113441127"
     variation       157
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377111827"
     variation       162
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370271242"
     CDS             180..1841
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /EC_number="2.7.1.30"
                     /note="isoform c is encoded by transcript variant 3;
                     ATP:glycerol 3-phosphotransferase; glycerokinase"
                     /codon_start=1
                     /product="glycerol kinase isoform c"
                     /protein_id="NP_001121599.1"
                     /db_xref="GI:189409120"
                     /db_xref="CCDS:CCDS48090.1"
                     /db_xref="GeneID:2710"
                     /db_xref="HGNC:4289"
                     /db_xref="MIM:300474"
                     /translation="
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP
"
     misc_feature    210..1718
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="Metazoan glycerol kinase 1 and 3-like proteins;
                     belongs to the FGGY family of carbohydrate kinases;
                     Region: FGGY_GK1-3_metazoa; cd07792"
                     /db_xref="CDD:212664"
     misc_feature    210..1718
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="glycerol kinase; Region: glycerol_kin; TIGR01311"
                     /db_xref="CDD:162296"
     misc_feature    order(213..218,222..224,228..230,237..242,249..257,
                     261..266,276..278,282..284,330..332,435..452,459..461,
                     519..530,537..542,549..551,591..596,600..611,615..617,
                     621..626,774..779,786..791,801..803,807..812,816..818,
                     882..896,933..935,939..944,1020..1022,1029..1031,
                     1053..1064,1074..1100,1119..1121,1125..1127,1134..1136,
                     1140..1151,1167..1169,1269..1274,1293..1295,1299..1304,
                     1308..1310,1536..1538,1542..1550,1554..1580,1584..1589,
                     1614..1619)
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="putative N- and C-terminal domain interface
                     [polypeptide binding]; other site"
                     /db_xref="CDD:212664"
     misc_feature    order(228..230,234..245,249..251,456..464,519..521,
                     621..623,954..959,1014..1022,1029..1031,1155..1160,
                     1164..1169,1203..1208,1212..1214,1455..1463,1470..1472)
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="active site"
                     /db_xref="CDD:212664"
     misc_feature    order(228..230,234..245,249..251,954..956,1014..1022,
                     1155..1160,1164..1169,1203..1208,1212..1214,1455..1463,
                     1470..1472)
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:212664"
     misc_feature    order(228..230,237..239,954..956)
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="catalytic site [active]"
                     /db_xref="CDD:212664"
     misc_feature    order(228..230,954..956)
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212664"
     misc_feature    order(300..302,351..356,360..365,372..377,384..389,
                     495..497,732..734,741..743,909..914)
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="putative homotetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212664"
     misc_feature    order(318..320,327..329,336..338,522..524,1149..1151,
                     1158..1160,1170..1172,1179..1181,1248..1250,1254..1256,
                     1269..1271,1305..1334,1344..1349,1353..1355,1683..1685)
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212664"
     misc_feature    order(459..464,519..521,621..623,954..956)
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /note="putative glycerol binding site [chemical binding];
                     other site"
                     /db_xref="CDD:212664"
     variation       223
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201406258"
     exon            258..331
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     exon            332..438
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       344
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34795481"
     variation       365
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:45537438"
     variation       416
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:17857267"
     exon            439..516
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       445
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368340300"
     variation       511
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201622490"
     exon            517..593
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       551
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149553741"
     variation       570
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17854203"
     exon            594..731
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       669
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199782390"
     variation       680
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17854202"
     exon            732..841
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       734
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:148306668"
     variation       752
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367693560"
     exon            842..908
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     exon            909..944
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       932
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61730292"
     variation       944
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201629061"
     exon            945..1012
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       949
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61739587"
     exon            1013..1055
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       1041
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:132630331"
     exon            1056..1136
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       1073
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141460778"
     variation       1103
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367704871"
     exon            1137..1215
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       1168
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371481560"
     variation       1178
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146346162"
     variation       1211
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200898041"
     exon            1216..1312
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     STS             1240..1357
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /standard_name="GK"
                     /db_xref="UniSTS:506551"
     variation       1259
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200152844"
     variation       1274
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139652893"
     exon            1313..1397
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       1371
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61740818"
     exon            1398..1518
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       1411
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61730293"
     variation       1416
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:132630329"
     variation       1428
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113389040"
     variation       1498
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:132630328"
     variation       1515
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375131981"
     exon            1519..1662
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       1560
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:369956146"
     variation       1584
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144409441"
     variation       1587
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61742225"
     variation       1610
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373405873"
     variation       1637
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370464342"
     exon            1663..1743
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       1669
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146142647"
     variation       1685
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61730295"
     variation       1686
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:132630330"
     variation       1709
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377416052"
     exon            1744..1830
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       1754
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377501703"
     exon            1831..4561
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /inference="alignment:Splign:1.39.8"
     variation       1852
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1803659"
     STS             1953..2129
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /standard_name="RH16"
                     /db_xref="UniSTS:4226"
     polyA_signal    1996..2001
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
     variation       2031
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182551917"
     polyA_site      2033
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
     variation       2042
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34867477"
     STS             2060..2121
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /standard_name="GDB:655772"
                     /db_xref="UniSTS:52343"
     variation       2181
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3931219"
     variation       2182
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187871122"
     STS             2261..2342
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /standard_name="RH92654"
                     /db_xref="UniSTS:90021"
     STS             2587..2721
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /standard_name="RH38757"
                     /db_xref="UniSTS:86741"
     polyA_signal    2786..2791
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
     polyA_site      2812
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
     variation       2838
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138317985"
     variation       2870
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201500166"
     variation       2953
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:5972215"
     variation       3023
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:192553031"
     variation       3033
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:111524220"
     variation       3085
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73632545"
     variation       3108
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:5972216"
     variation       3120
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:5972217"
     variation       3124
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:5972218"
     variation       3158
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:5972219"
     variation       3237
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:5972220"
     variation       3253
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142179849"
     variation       3266
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:5926945"
     variation       3275
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:5972221"
     STS             3312..3459
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /standard_name="RH93765"
                     /db_xref="UniSTS:91920"
     variation       3320
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73452162"
     variation       3380
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:5927597"
     variation       3457
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:5972222"
     variation       3518
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377422043"
     variation       3624
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:5926946"
     variation       3627
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:5927598"
     polyA_signal    3685..3690
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
     polyA_site      3713
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
     variation       3740
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146509969"
     variation       3762
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187274085"
     variation       3781
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191998784"
     variation       3890..3891
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:373925548"
     variation       4033
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:140725888"
     variation       4063
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2170611"
     variation       4066
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375515904"
     variation       4124
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:5927599"
     variation       4293
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:28551561"
     variation       4300
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:207478216"
     variation       4310
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:184459838"
     variation       4409
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189289452"
     polyA_signal    4541..4546
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
     polyA_site      4561
                     /gene="GK"
                     /gene_synonym="GK1; GKD"
ORIGIN      
gggccggaggggcggggtgagaaggctgcgcgcgggtaaaggggccgcctcgagcgcggtccgagcgttcagcggacgcgcgcggcctcgatctctggactcgtcacctgcccctccccctcccgccgccgtcacccaggaaaccggccgcaatcgccggccgacctgaagctggtttcatggcagcctcaaagaaggcagttttggggccattggtgggggcggtggaccagggcaccagttcgacgcgctttttggttttcaattcaaaaacagctgaactacttagtcatcatcaagtagaaataaaacaagagttcccaagagaaggatgggtggaacaggaccctaaggaaattctacattctgtctatgagtgtatagagaaaacatgtgagaaacttggacagctcaatattgatatttccaacataaaagctattggtgtcagcaaccagagggaaaccactgtagtctgggacaagataactggagagcctctctacaatgctgtggtgtggcttgatctaagaacccagtctaccgttgagagtcttagtaaaagaattccaggaaataataactttgtcaagtccaagacaggccttccacttagcacttacttcagtgcagtgaaacttcgttggctccttgacaatgtgagaaaagttcaaaaggccgttgaagaaaaacgagctctttttgggactattgattcatggcttatttggagtttgacaggaggagtcaatggaggtgtccactgtacagatgtaacaaatgcaagtaggactatgcttttcaacattcattctttggaatgggataaacaactctgcgaattttttggaattccaatggaaattcttccaaatgtccggagttcttctgagatctatggcctaatgaaagctggggccttggaaggtgtgccaatatctgggtgtttaggggaccagtctgctgcattggtgggacaaatgtgcttccagattggacaagccaaaaatacgtatggaacaggatgtttcttactatgtaatacaggccataagtgtgtattttctgatcatggccttctcaccacagtggcttacaaacttggcagagacaaaccagtatattatgctttggaaggttctgtagctatagctggtgctgttattcgctggctaagagacaatcttggaattataaagacctcagaagaaattgaaaaacttgctaaagaagtaggtacttcttatggctgctacttcgtcccagcattttcggggttatatgcaccttattgggagcccagcgcaagagggataatctgtggactcactcagttcaccaataaatgccatattgcttttgctgcattagaagctgtttgtttccaaactcgagagattttggatgccatgaatcgagactgtggaattccactcagtcatttgcaggtagatggaggaatgaccagcaacaaaattcttatgcagctacaagcagacattctgtatataccagtagtgaagccctcaatgcccgaaaccactgcactgggtgcggctatggcggcaggggctgcagaaggagtcggcgtatggagtctcgaacccgaggatttgtctgccgtcacgatggagcggtttgaacctcagattaatgcggaggaaagtgaaattcgttattctacatggaagaaagctgtgatgaagtcaatgggttgggttacaactcaatctccagaaagtggtgaccctagtatcttctgtagtctgcccttgggcttttttatagtgagtagcatggtaatgttaatcggagcaaggtacatctcaggtattccataaaacctaccaactcatggattcccaagatgtgagctttttacataatgaaagaacccagcaattctgtctcttaatgcaatgacactattcatagactttgattttatttataagccacttgctgcatgaccctccaagtagacctgtggcttaaaataaagaaaatgcagcaaaaagaatgctatagaaatatttggtggttttttttttttttaaacatccacagttaaggttgggccagctacctttggggctgaccccctccattgccataacatcctgctccattccctctaagatgtaggaagaattcggatccttaccattggaatcttccatcgaacatactcaaacacttttggaccaggatttgagtctctgcatgacatatacttgattaaaaggttattactaacctgttaaaaatcagcagctctttgcttttaacagacaccctaaaagtcttcttttctacatagttgaagacagcaacatcttcactgaatgtttgaatagaaacctctactaaattattaaaatagacatttagtgttctcacagcttggatatttttctgaaaagttatttgccaaaactgaaatccttcagatgttttccatggtcccactaattataatgactttctgtctggatcttataggaaaagatactttcttttttcttccatctttcctttttatattttttactttgtatgtataacatacatgcctatatattttatacactgagggtagcccatttataaattaagagcacattatattcagaaggttctaacagggctggtcttaagtgaaccactgtgtatataaatatgttggaaaacagctgtatacatttttgggcaacggttatgcataatatttaccaggagaatttttttcttaacaagccaacatttaaaatttatgttttatgtcaataaaagaaaatatactttattgtgacttcaactatatttcttatcccttacatttttatttaattgtcttagcttaaaaaaagaagaaactgtggaatactacagtaaatattgttttcaaacacaagcaataattcaaatagttatttttcttttgaattaattttagacatattttggatcctattgaggggataagaggatgtcaaaaaagttaaatacctaagtagaaaaaaatatagaaataaagccaagaatctctttcagttcaaatgttatcaattgttaataagaaattgctatctgggatgacagaattacctctgcttagtatctcattataactgaaagaaggtttatcattacaaataccttccaatgaaaccaagaatttctcaaaatatttaatgtcacatattataagaagttacctaatcctgcttcttaacatcaatttttaaaaatatcttaaaattactttgttttgtagtaaacagtgaagaaaagattgcctcctaattatttttttcaatgagtgctgaatgggaaaacatttatatcttactataaaaggttctgttttgtttggaatcaatggtagctttattgactgttctgattgtgctgtttctaatttattgaatctgctaggttttattgatgcagccaccacttaagtgacataaatattatagaaaggtactgtgaaatgatcactttgtggcaggggtacttttaaacataaatgtttctacaaaagtaggttgagttcattgtaaataattgtgaaagccactgttcaaataattttaagattacattaatttttctataaattggaagatttataaatgtttgaaattgtacacattgatatttaatgacaaatttacttaaaataaattgaccccttgttcttacttgcatttctcatttacagactagaacttagttgaaagttaaattaagaaagatgtttcagaggccgggcacggtggctgacgcctgtaatcccagcactttgggaggccgaggtgggcagatcacctgaggtcaggagttcgggactagcctaaccgacatggagaaaccctatctctactaaaaaaaaaaaaagatgtttcaggacatgtgaaacttggctgttagcgcttgatagggcacactctgaagagttaaccaacagccaaagaagtaatttctgtaatgatgaacactttaatcattctattagaagaaactacactgtcccatctcagcatttgcaaaaaataatgttggtaaggtcagcagccattatcaacagggccttgcatggctaactttgaccaccatttttctctcaacctgataggcaacacctcaatcctttgttctccaactaatcagtaaaataagtaatgcatctctgcttctgtaatgatatcttagaatttttagtatgtttcttttgaagtgcccaaagcccaattctttgggatatcttttgggtatctggtatcatgtgggagtgaagaaagaaagtttttggagaaaccaacaaatgaaagctgtgatagcacagaagctaatggcattgacagtggagtaggtagtatttaatctgtagtgtttacaacatagtagatagaagtacaaaaatttttttaactataactctttaatagcttgttttatctagtaatatttaaataatgaagtttccttgatcctttgcttttgcaacctaacaactttaataataagttcacacaataaacaaattagtagaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:2710 -> Molecular function: GO:0004370 [glycerol kinase activity] evidence: IMP
            GeneID:2710 -> Molecular function: GO:0004370 [glycerol kinase activity] evidence: NAS
            GeneID:2710 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:2710 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
            GeneID:2710 -> Biological process: GO:0006071 [glycerol metabolic process] evidence: IMP
            GeneID:2710 -> Biological process: GO:0006071 [glycerol metabolic process] evidence: NAS
            GeneID:2710 -> Biological process: GO:0006641 [triglyceride metabolic process] evidence: IMP
            GeneID:2710 -> Biological process: GO:0019432 [triglyceride biosynthetic process] evidence: TAS
            GeneID:2710 -> Biological process: GO:0019563 [glycerol catabolic process] evidence: IEA
            GeneID:2710 -> Biological process: GO:0044255 [cellular lipid metabolic process] evidence: TAS
            GeneID:2710 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
            GeneID:2710 -> Biological process: GO:0046167 [glycerol-3-phosphate biosynthetic process] evidence: IMP
            GeneID:2710 -> Cellular component: GO:0005737 [cytoplasm] evidence: NAS
            GeneID:2710 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: NAS
            GeneID:2710 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_001121599 -> EC 2.7.1.30

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.