2024-03-28 22:53:07, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001127184 1299 bp mRNA linear PRI 15-JUL-2013 DEFINITION Homo sapiens CASP8 and FADD-like apoptosis regulator (CFLAR), transcript variant 3, mRNA. ACCESSION NM_001127184 VERSION NM_001127184.2 GI:321267565 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1299) AUTHORS Wilkie-Grantham,R.P., Matsuzawa,S. and Reed,J.C. TITLE Novel phosphorylation and ubiquitination sites regulate reactive oxygen species-dependent degradation of anti-apoptotic c-FLIP protein JOURNAL J. Biol. Chem. 288 (18), 12777-12790 (2013) PUBMED 23519470 REMARK GeneRIF: novel ROS-dependent post-translational modifications of the c-FLIP protein that regulate its stability, thus impacting sensitivity of cancer cells to TRAIL. REFERENCE 2 (bases 1 to 1299) AUTHORS Rao-Bindal,K., Rao,C.K., Yu,L. and Kleinerman,E.S. TITLE Expression of c-FLIP in pulmonary metastases in osteosarcoma patients and human xenografts JOURNAL Pediatr Blood Cancer 60 (4), 575-579 (2013) PUBMED 23255321 REMARK GeneRIF: c-FLIP may play an important role in the metastatic potential of osteosarcoma to the lung REFERENCE 3 (bases 1 to 1299) AUTHORS Silke,J. and Strasser,A. TITLE The FLIP Side of Life JOURNAL Sci Signal 6 (258), PE2 (2013) PUBMED 23322903 REMARK GeneRIF: Studies indicate that the anti-apoptotic protein c-FLIP is an important regulator of death receptor signaling, including TNFR1, Fas, DR4, and DR5. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1299) AUTHORS Rasper,D.M., Vaillancourt,J.P., Hadano,S., Houtzager,V.M., Seiden,I., Keen,S.L., Tawa,P., Xanthoudakis,S., Nasir,J., Martindale,D., Koop,B.F., Peterson,E.P., Thornberry,N.A., Huang,J., MacPherson,D.P., Black,S.C., Hornung,F., Lenardo,M.J., Hayden,M.R., Roy,S. and Nicholson,D.W. TITLE Cell death attenuation by 'Usurpin', a mammalian DED-caspase homologue that precludes caspase-8 recruitment and activation by the CD-95 (Fas, APO-1) receptor complex JOURNAL Cell Death Differ. 5 (4), 271-288 (1998) PUBMED 10200473 REFERENCE 5 (bases 1 to 1299) AUTHORS Goltsev,Y.V., Kovalenko,A.V., Arnold,E., Varfolomeev,E.E., Brodianskii,V.M. and Wallach,D. TITLE CASH, a novel caspase homologue with death effector domains JOURNAL J. Biol. Chem. 272 (32), 19641-19644 (1997) PUBMED 9289491 REFERENCE 6 (bases 1 to 1299) AUTHORS Srinivasula,S.M., Ahmad,M., Ottilie,S., Bullrich,F., Banks,S., Wang,Y., Fernandes-Alnemri,T., Croce,C.M., Litwack,G., Tomaselli,K.J., Armstrong,R.C. and Alnemri,E.S. TITLE FLAME-1, a novel FADD-like anti-apoptotic molecule that regulates Fas/TNFR1-induced apoptosis JOURNAL J. Biol. Chem. 272 (30), 18542-18545 (1997) PUBMED 9228018 REFERENCE 7 (bases 1 to 1299) AUTHORS Kim,T.W., Pettingell,W.H., Jung,Y.K., Kovacs,D.M. and Tanzi,R.E. TITLE Alternative cleavage of Alzheimer-associated presenilins during apoptosis by a caspase-3 family protease JOURNAL Science 277 (5324), 373-376 (1997) PUBMED 9219695 REFERENCE 8 (bases 1 to 1299) AUTHORS Hu,S., Vincenz,C., Ni,J., Gentz,R. and Dixit,V.M. TITLE I-FLICE, a novel inhibitor of tumor necrosis factor receptor-1- and CD-95-induced apoptosis JOURNAL J. Biol. Chem. 272 (28), 17255-17257 (1997) PUBMED 9211860 REFERENCE 9 (bases 1 to 1299) AUTHORS Irmler,M., Thome,M., Hahne,M., Schneider,P., Hofmann,K., Steiner,V., Bodmer,J.L., Schroter,M., Burns,K., Mattmann,C., Rimoldi,D., French,L.E. and Tschopp,J. TITLE Inhibition of death receptor signals by cellular FLIP JOURNAL Nature 388 (6638), 190-195 (1997) PUBMED 9217161 REFERENCE 10 (bases 1 to 1299) AUTHORS Shu,H.B., Halpin,D.R. and Goeddel,D.V. TITLE Casper is a FADD- and caspase-related inducer of apoptosis JOURNAL Immunity 6 (6), 751-763 (1997) PUBMED 9208847 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK296036.1, Y14040.1 and AF005775.1. On Feb 3, 2011 this sequence version replaced gi:187608584. Summary: The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists. [provided by RefSeq, Feb 2011]. Transcript Variant: This variant (3) represents use of an alternate coding exon that results in a shorter protein isoform (2) with a distinct C-terminus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: Y14040.1, BQ644010.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-26 AK296036.1 1-26 27-404 Y14040.1 42-419 405-891 Y14040.1 421-907 892-1299 AF005775.1 427-834 FEATURES Location/Qualifiers source 1..1299 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" /map="2q33-q34" gene 1..1299 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /note="CASP8 and FADD-like apoptosis regulator" /db_xref="GeneID:8837" /db_xref="HGNC:1876" /db_xref="MIM:603599" exon 1..328 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /inference="alignment:Splign:1.39.8" variation 4 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="c" /replace="g" /db_xref="dbSNP:78384838" variation 31 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="c" /replace="t" /db_xref="dbSNP:189589369" STS 58..253 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /standard_name="A008B37" /db_xref="UniSTS:67797" variation 70 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="a" /replace="g" /db_xref="dbSNP:184055782" variation 324 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="" /replace="g" /db_xref="dbSNP:370175319" exon 329..746 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /inference="alignment:Splign:1.39.8" variation 357 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="a" /replace="g" /db_xref="dbSNP:192733942" variation 367..368 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="" /replace="agccctcagaaatgaagtt" /db_xref="dbSNP:376356547" variation 417 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="c" /replace="t" /db_xref="dbSNP:10931931" variation 435 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="c" /replace="t" /db_xref="dbSNP:184779247" misc_feature 451..453 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /note="upstream in-frame stop codon" variation 455..456 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="" /replace="t" /db_xref="dbSNP:200933932" variation 456 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="c" /replace="t" /db_xref="dbSNP:367710240" CDS 466..1131 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /note="isoform 2 is encoded by transcript variant 3; inhibitor of FLICE; caspase-related inducer of apoptosis; FADD-like anti-apoptotic molecule; usurpin beta; caspase homolog; caspase-eight-related protein; MACH-related inducer of toxicity; FADD-like antiapoptotic molecule 1; cellular FLICE-like inhibitory protein; caspase-like apoptosis regulatory protein" /codon_start=1 /product="CASP8 and FADD-like apoptosis regulator isoform 2" /protein_id="NP_001120656.1" /db_xref="GI:187608585" /db_xref="CCDS:CCDS46487.1" /db_xref="GeneID:8837" /db_xref="HGNC:1876" /db_xref="MIM:603599" /translation="
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRMITPYAHCPDLKILGNCSM
" misc_feature 466..1050 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O15519.1); Region: Interaction with caspase-8" misc_feature 466..705 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /note="Death Effector Domain, repeat 1, of cellular FLICE-Inhibitory Protein; Region: DED_c-FLIP_repeat1; cd08337" /db_xref="CDD:176748" misc_feature order(508..513,523..525,532..537,541..546,634..636, 646..648) /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /note="DED1/DED2 interface [polypeptide binding]; other site" /db_xref="CDD:176748" misc_feature order(514..516,655..657,661..663) /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /note="charge triad; other site" /db_xref="CDD:176748" misc_feature 736..978 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /note="Death Effector Domain, repeat 2, of cellular FLICE-Inhibitory Protein; Region: DED_c-FLIP_repeat2; cd08340" /db_xref="CDD:176751" misc_feature order(736..738,745..750,754..759,769..771,853..855, 859..861,871..873) /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /note="DED1/DED2 interface [polypeptide binding]; other site" /db_xref="CDD:176751" misc_feature order(787..789,946..948,952..954) /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /note="charge triad; other site" /db_xref="CDD:176751" variation 621 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="c" /replace="t" /db_xref="dbSNP:149769889" variation 622 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="a" /replace="g" /db_xref="dbSNP:371383444" variation 730 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="a" /replace="c" /db_xref="dbSNP:374815211" exon 747..852 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /inference="alignment:Splign:1.39.8" variation 789 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="g" /replace="t" /db_xref="dbSNP:369789091" variation 790 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="a" /replace="g" /db_xref="dbSNP:61759466" variation 819 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="g" /replace="t" /db_xref="dbSNP:145567470" variation 823 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="a" /replace="g" /db_xref="dbSNP:74654642" variation 825 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="a" /replace="g" /db_xref="dbSNP:148372596" variation 829 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="c" /replace="t" /db_xref="dbSNP:150296080" variation 845 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="a" /replace="g" /db_xref="dbSNP:146003529" exon 853..988 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /inference="alignment:Splign:1.39.8" exon 989..1071 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /inference="alignment:Splign:1.39.8" variation 1032 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="a" /replace="c" /db_xref="dbSNP:138647536" exon 1072..1298 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /inference="alignment:Splign:1.39.8" STS 1082..1230 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /standard_name="RH98318" /db_xref="UniSTS:86750" STS 1130..1229 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /standard_name="D2S2141" /db_xref="UniSTS:17406" STS 1137..1261 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /standard_name="WI-12098" /db_xref="UniSTS:15976" variation 1199 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" /replace="c" /replace="t" /db_xref="dbSNP:184131473" polyA_signal 1275..1280 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" polyA_site 1298 /gene="CFLAR" /gene_synonym="c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT" ORIGIN
atactcagtcacacaagccatagcaggaaacagcgagcttgcagcctcaccgacgagtctcaactaaaagggactcccggagctaggggtggggactcggcctcacacagtgagtgccggctattggacttttgtccagtgacagctgagacaacaaggaccacgggaggaggtgtaggagagaagcgccgcgaacagcgatcgcccagcaccaagtccgcttccaggctttcggtttctttgcctccatcttgggtgcgccttcccggcgtctaggggagcgaaggctgaggtggcagcggcaggagagtccggccgcgacaggacgaactcccccactggaaaggattctgaaagaaatgaagtcagccctcagaaatgaagttgactgcctgctggctttctgttgactggcccggagctgtactgcaagacccttgtgagcttccctagtctaagagtaggatgtctgctgaagtcatccatcaggttgaagaagcacttgatacagatgagaaggagatgctgctctttttgtgccgggatgttgctatagatgtggttccacctaatgtcagggaccttctggatattttacgggaaagaggtaagctgtctgtcggggacttggctgaactgctctacagagtgaggcgatttgacctgctcaaacgtatcttgaagatggacagaaaagctgtggagacccacctgctcaggaaccctcaccttgtttcggactatagagtgctgatggcagagattggtgaggatttggataaatctgatgtgtcctcattaattttcctcatgaaggattacatgggccgaggcaagataagcaaggagaagagtttcttggaccttgtggttgagttggagaaactaaatctggttgccccagatcaactggatttattagaaaaatgcctaaagaacatccacagaatagacctgaagacaaaaatccagaagtacaagcagtctgttcaaggagcagggacaagttacaggaatgttctccaagcagcaatccaaaagagtctcaaggatccttcaaataacttcaggatgataacaccctatgcccattgtcctgatctgaaaattcttggaaattgttccatgtgattaacatggaactgcctctacttaatcattctgaatgattaaatcgtttcattttctaaatgtgttataatgtgtttagccctttcttgttgctgtatgtttagatgctttccaatcttttgttactactaataatgctataaaataaatatccttgtacttctttga
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:8837 -> Molecular function: GO:0002020 [protease binding] evidence: IPI GeneID:8837 -> Molecular function: GO:0004197 [cysteine-type endopeptidase activity] evidence: IEA GeneID:8837 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:8837 -> Molecular function: GO:0008047 [enzyme activator activity] evidence: IDA GeneID:8837 -> Biological process: GO:0006508 [proteolysis] evidence: IEA GeneID:8837 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:8837 -> Biological process: GO:0007519 [skeletal muscle tissue development] evidence: ISS GeneID:8837 -> Biological process: GO:0014732 [skeletal muscle atrophy] evidence: ISS GeneID:8837 -> Biological process: GO:0014842 [regulation of satellite cell proliferation] evidence: ISS GeneID:8837 -> Biological process: GO:0014866 [skeletal myofibril assembly] evidence: ISS GeneID:8837 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA GeneID:8837 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS GeneID:8837 -> Biological process: GO:0043085 [positive regulation of catalytic activity] evidence: IDA GeneID:8837 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IEP GeneID:8837 -> Biological process: GO:0043403 [skeletal muscle tissue regeneration] evidence: ISS GeneID:8837 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: ISS GeneID:8837 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS GeneID:8837 -> Biological process: GO:1901740 [negative regulation of myoblast fusion] evidence: ISS GeneID:8837 -> Biological process: GO:1902042 [negative regulation of extrinsic apoptotic signaling pathway via death domain receptors] evidence: IMP GeneID:8837 -> Biological process: GO:2001237 [negative regulation of extrinsic apoptotic signaling pathway] evidence: IDA GeneID:8837 -> Biological process: GO:2001237 [negative regulation of extrinsic apoptotic signaling pathway] evidence: IMP GeneID:8837 -> Biological process: GO:2001239 [regulation of extrinsic apoptotic signaling pathway in absence of ligand] evidence: TAS GeneID:8837 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:8837 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:8837 -> Cellular component: GO:0031264 [death-inducing signaling complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.