2024-04-24 02:32:43, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001126113 2651 bp mRNA linear PRI 08-JUL-2013 DEFINITION Homo sapiens tumor protein p53 (TP53), transcript variant 4, mRNA. ACCESSION NM_001126113 VERSION NM_001126113.2 GI:371502116 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2651) AUTHORS Marcel,V., Tran,P.L., Sagne,C., Martel-Planche,G., Vaslin,L., Teulade-Fichou,M.P., Hall,J., Mergny,J.L., Hainaut,P. and Van Dyck,E. TITLE G-quadruplex structures in TP53 intron 3: role in alternative splicing and in production of p53 mRNA isoforms JOURNAL Carcinogenesis 32 (3), 271-278 (2011) PUBMED 21112961 REFERENCE 2 (bases 1 to 2651) AUTHORS Marcel,V., Perrier,S., Aoubala,M., Ageorges,S., Groves,M.J., Diot,A., Fernandes,K., Tauro,S. and Bourdon,J.C. TITLE Delta160p53 is a novel N-terminal p53 isoform encoded by Delta133p53 transcript JOURNAL FEBS Lett. 584 (21), 4463-4468 (2010) PUBMED 20937277 REMARK GeneRIF: Delta133p53 transcript generates two different p53 isoforms, Delta133p53 and Delta160p53 REFERENCE 3 (bases 1 to 2651) AUTHORS Anczukow,O., Ware,M.D., Buisson,M., Zetoune,A.B., Stoppa-Lyonnet,D., Sinilnikova,O.M. and Mazoyer,S. TITLE Does the nonsense-mediated mRNA decay mechanism prevent the synthesis of truncated BRCA1, CHK2, and p53 proteins? JOURNAL Hum. Mutat. 29 (1), 65-73 (2008) PUBMED 17694537 REMARK GeneRIF: the p53 protein encoded by the 770delT allele is as abundant as the wild-type protein, as removal of the C-terminal p53 domain leads to a stabilized mutant protein, whose abundance is markedly increased when NMD is inhibited. REFERENCE 4 (bases 1 to 2651) AUTHORS Bourdon,J.C. TITLE p53 Family isoforms JOURNAL Curr Pharm Biotechnol 8 (6), 332-336 (2007) PUBMED 18289041 REMARK Review article REFERENCE 5 (bases 1 to 2651) AUTHORS Candeias,M.M., Powell,D.J., Roubalova,E., Apcher,S., Bourougaa,K., Vojtesek,B., Bruzzoni-Giovanelli,H. and Fahraeus,R. TITLE Expression of p53 and p53/47 are controlled by alternative mechanisms of messenger RNA translation initiation JOURNAL Oncogene 25 (52), 6936-6947 (2006) PUBMED 16983332 REMARK GeneRIF: harbouring alternative translation initiation sites, the p53 mRNA gives rise to different levels of the p53 isoforms which help to orchestrate the cell biological outcome of p53 activation REFERENCE 6 (bases 1 to 2651) AUTHORS Lamb,P. and Crawford,L. TITLE Characterization of the human p53 gene JOURNAL Mol. Cell. Biol. 6 (5), 1379-1385 (1986) PUBMED 2946935 REFERENCE 7 (bases 1 to 2651) AUTHORS Isobe,M., Emanuel,B.S., Givol,D., Oren,M. and Croce,C.M. TITLE Localization of gene for human p53 tumour antigen to band 17p13 JOURNAL Nature 320 (6057), 84-85 (1986) PUBMED 3456488 REFERENCE 8 (bases 1 to 2651) AUTHORS Benchimol,S., Lamb,P., Crawford,L.V., Sheer,D., Shows,T.B., Bruns,G.A. and Peacock,J. TITLE Transformation associated p53 protein is encoded by a gene on human chromosome 17 JOURNAL Somat. Cell Mol. Genet. 11 (5), 505-510 (1985) PUBMED 2994241 REFERENCE 9 (bases 1 to 2651) AUTHORS Harlow,E., Williamson,N.M., Ralston,R., Helfman,D.M. and Adams,T.E. TITLE Molecular cloning and in vitro expression of a cDNA clone for human cellular tumor antigen p53 JOURNAL Mol. Cell. Biol. 5 (7), 1601-1610 (1985) PUBMED 3894933 REFERENCE 10 (bases 1 to 2651) AUTHORS Zakut-Houri,R., Bienz-Tadmor,B., Givol,D. and Oren,M. TITLE Human p53 cellular tumor antigen: cDNA sequence and expression in COS cells JOURNAL EMBO J. 4 (5), 1251-1255 (1985) PUBMED 4006916 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA453049.1, DQ186649.1, AK223026.1 and DQ186650.1. This sequence is a reference standard in the RefSeqGene project. On Jan 7, 2012 this sequence version replaced gi:187830822. Summary: This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons (PMIDs: 12032546, 20937277). [provided by RefSeq, Feb 2013]. Transcript Variant: This variant (4) contains an additional exon in the 3' coding region, resulting in an alternate 3' coding region and 3' UTR, compared to variant 1. This variant can initiate translation from two in-frame AUG start codons. The isoform represented in this variant (c, also known as p53gamma) results from translation initiation at the upstream start codon. It has a shorter and distinct C-terminus, compared to isoform a. CCDS Note: This CCDS ID represents the p53gamma isoform described in PMIDs: 16131611, 16601753 and 18289041. This variant is supported by the transcript DQ186649.1. It should be noted that this transcript is predicted to undergo nonsense-mediated mRNA decay (NMD). However, the protein is represented because other similar isoforms derived from NMD transcripts were detected endogenously in PMID:16131611. In addition, experiments in PMID:17694537 indicate that this gene may be somewhat less sensitive to NMD. A contributing factor is the presence of a ubiquitination domain in the C-terminus of the full-length protein, which makes the protein less stable under non-stress conditions. C-terminally truncated proteins that lack the ubiquitination domain, such as this isoform, are therefore more stable. NMD inhibition experiments in the same study show that the majority of NMD transcripts do indeed undergo NMD, but some low level of NMD escape, combined with the increased stability of C-terminally truncated isoforms, allows for the expression of such isoforms. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: DQ186649.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025084, ERS025088 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## NMD candidate :: translation inferred ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-88 DA453049.1 1-88 89-1758 DQ186649.1 19-1688 1759-2632 AK223026.1 792-1665 2633-2651 DQ186650.1 2257-2275 FEATURES Location/Qualifiers source 1..2651 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17p13.1" gene 1..2651 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="tumor protein p53" /db_xref="GeneID:7157" /db_xref="HGNC:11998" /db_xref="MIM:191170" exon 1..174 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" variation 92 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:17884410" misc_feature 95..97 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="upstream in-frame stop codon" exon 175..276 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" CDS 203..1243 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="isoform c is encoded by transcript variant 4; cellular tumor antigen p53; phosphoprotein p53; transformation-related protein 53; p53 tumor suppressor; antigen NY-CO-13" /codon_start=1 /product="cellular tumor antigen p53 isoform c" /protein_id="NP_001119585.1" /db_xref="GI:187830823" /db_xref="CCDS:CCDS45605.1" /db_xref="GeneID:7157" /db_xref="HGNC:11998" /db_xref="MIM:191170" /translation="
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQMLLDLRWCYFLINSS
" misc_feature 215..289 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="P53 transactivation motif; Region: P53_TAD; pfam08563" /db_xref="CDD:149567" misc_feature 320..322 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="delta40p53gamma; Region: alternative start codon" misc_feature 527..1066 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="P53 DNA-binding domain; Region: P53; cd08367" /db_xref="CDD:176262" misc_feature order(728..730,737..739,914..916,926..928) /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="zinc binding site [ion binding]; other site" /db_xref="CDD:176262" misc_feature order(731..739,743..745) /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="dimerization site [polypeptide binding]; other site" /db_xref="CDD:176262" misc_feature order(917..919,923..925,944..946,1019..1021,1025..1033, 1040..1042) /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:176262" variation 265 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="t" /db_xref="dbSNP:1800369" exon 277..298 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" exon 299..577 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" variation 304 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="c" /db_xref="dbSNP:11575998" STS 305..503 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /standard_name="GDB:177814" /db_xref="UniSTS:154969" variation 310 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:1800370" STS 319..577 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /standard_name="GDB:177797" /db_xref="UniSTS:154963" variation 341 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="t" /db_xref="dbSNP:1800371" variation 531 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:11540654" exon 578..761 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" variation 661 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="t" /db_xref="dbSNP:72661116" STS 680..754 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /standard_name="PMC340938P3" /db_xref="UniSTS:273171" variation 752 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:72661117" exon 762..874 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" variation 841 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1800372" variation 851 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:35163653" variation 868 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:72661118" exon 875..984 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" STS 955..1153 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /standard_name="PMC310707P2" /db_xref="UniSTS:272633" STS 959..1033 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /standard_name="GDB:190076" /db_xref="UniSTS:155620" exon 985..1121 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" variation 989 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:72661119" variation 1105 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:72661120" exon 1122..1195 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" variation 1195 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:11575996" exon 1196..1255 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" variation 1217 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="t" /db_xref="dbSNP:1642789" exon 1256..1362 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" variation 1277 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:17882252" variation 1341 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="g" /db_xref="dbSNP:35993958" variation 1358 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="g" /replace="t" /db_xref="dbSNP:17881470" exon 1363..2651 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /inference="alignment:Splign:1.39.8" variation 1481 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="t" /db_xref="dbSNP:1042526" STS 1514..1630 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /standard_name="D17S1678" /db_xref="UniSTS:82485" variation 1549 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="t" /db_xref="dbSNP:35919705" variation 1758 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:34486624" variation 1772 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:17881366" variation 1935 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:916131" variation 1958 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="t" /db_xref="dbSNP:916132" STS 1971..2117 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /standard_name="D17S1506E" /db_xref="UniSTS:151711" variation 1978..1979 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="t" /db_xref="dbSNP:1811095" variation 2014 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="" /replace="gt" /db_xref="dbSNP:17886358" variation 2057 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="c" /db_xref="dbSNP:17879353" variation 2078..2079 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:1794291" variation 2078 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="g" /db_xref="dbSNP:1042535" variation 2198 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="t" /db_xref="dbSNP:199729221" variation 2270 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:17884306" variation 2299 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="t" /db_xref="dbSNP:17884586" variation 2330 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="g" /db_xref="dbSNP:35659787" variation 2500..2501 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="c" /replace="g" /db_xref="dbSNP:1794292" STS 2506..2582 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /standard_name="WI-20715" /db_xref="UniSTS:59997" polyA_signal 2615..2620 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" variation 2619 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /replace="a" /replace="c" /db_xref="dbSNP:78378222" polyA_site 2632 /gene="TP53" /gene_synonym="BCC7; LFS1; P53; TRP53" /note="The 3' most polyA site has not been determined." ORIGIN
gatgggattggggttttcccctcccatgtgctcaagactggcgctaaaagttttgagcttctcaaaagtctagagccaccgtccagggagcaggtagctgctgggctccggggacactttgcgttcgggctgggagcgtgctttccacgacggtgacacgcttccctggattggcagccagactgccttccgggtcactgccatggaggagccgcagtcagatcctagcgtcgagccccctctgagtcaggaaacattttcagacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcaatggatgatttgatgctgtccccggacgatattgaacaatggttcactgaagacccaggtccagatgaagctcccagaatgccagaggctgctccccccgtggcccctgcaccagcagctcctacaccggcggcccctgcaccagccccctcctggcccctgtcatcttctgtcccttcccagaaaacctaccagggcagctacggtttccgtctgggcttcttgcattctgggacagccaagtctgtgacttgcacgtactcccctgccctcaacaagatgttttgccaactggccaagacctgccctgtgcagctgtgggttgattccacacccccgcccggcacccgcgtccgcgccatggccatctacaagcagtcacagcacatgacggaggttgtgaggcgctgcccccaccatgagcgctgctcagatagcgatggtctggcccctcctcagcatcttatccgagtggaaggaaatttgcgtgtggagtatttggatgacagaaacacttttcgacatagtgtggtggtgccctatgagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagttcctgcatgggcggcatgaaccggaggcccatcctcaccatcatcacactggaagactccagtggtaatctactgggacggaacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccggcgcacagaggaagagaatctccgcaagaaaggggagcctcaccacgagctgcccccagggagcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaagaaaccactggatggagaatatttcacccttcagatgctacttgacttacgatggtgttacttcctgataaactcgtcgtaagttgaaaatattatccgtgggcgtgagcgcttcgagatgttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaggagccaggggggagcagggctcactccagccacctgaagtccaaaaagggtcagtctacctcccgccataaaaaactcatgttcaagacagaagggcctgactcagactgacattctccacttcttgttccccactgacagcctcccacccccatctctccctcccctgccattttgggttttgggtctttgaacccttgcttgcaataggtgtgcgtcagaagcacccaggacttccatttgctttgtcccggggctccactgaacaagttggcctgcactggtgttttgttgtggggaggaggatggggagtaggacataccagcttagattttaaggtttttactgtgagggatgtttgggagatgtaagaaatgttcttgcagttaagggttagtttacaatcagccacattctaggtaggggcccacttcaccgtactaaccagggaagctgtccctcactgttgaattttctctaacttcaaggcccatatctgtgaaatgctggcatttgcacctacctcacagagtgcattgtgagggttaatgaaataatgtacatctggccttgaaaccaccttttattacatggggtctagaacttgacccccttgagggtgcttgttccctctccctgttggtcggtgggttggtagtttctacagttgggcagctggttaggtagagggagttgtcaagtctctgctggcccagccaaaccctgtctgacaacctcttggtgaaccttagtacctaaaaggaaatctcaccccatcccacaccctggaggatttcatctcttgtatatgatgatctggatccaccaagacttgttttatgctcagggtcaatttcttttttcttttttttttttttttttctttttctttgagactgggtctcgctttgttgcccaggctggagtggagtggcgtgatcttggcttactgcagcctttgcctccccggctcgagcagtcctgcctcagcctccggagtagctgggaccacaggttcatgccaccatggccagccaacttttgcatgttttgtagagatggggtctcacagtgttgcccaggctggtctcaaactcctgggctcaggcgatccacctgtctcagcctcccagagtgctgggattacaattgtgagccaccacgtccagctggaagggtcaacatcttttacattctgcaagcacatctgcattttcaccccacccttcccctccttctccctttttatatcccatttttatatcgatctcttattttacaataaaactttgctgccacctgtgtgtctgaggggtg
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:7157 -> Molecular function: GO:0001077 [RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription] evidence: IEA GeneID:7157 -> Molecular function: GO:0001085 [RNA polymerase II transcription factor binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0001228 [RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription] evidence: IDA GeneID:7157 -> Molecular function: GO:0002020 [protease binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0002039 [p53 binding] evidence: IBA GeneID:7157 -> Molecular function: GO:0003677 [DNA binding] evidence: IMP GeneID:7157 -> Molecular function: GO:0003682 [chromatin binding] evidence: IDA GeneID:7157 -> Molecular function: GO:0003684 [damaged DNA binding] evidence: IBA GeneID:7157 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IDA GeneID:7157 -> Molecular function: GO:0005507 [copper ion binding] evidence: IDA GeneID:7157 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0005524 [ATP binding] evidence: IDA GeneID:7157 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0008270 [zinc ion binding] evidence: TAS GeneID:7157 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0030971 [receptor tyrosine kinase binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0031625 [ubiquitin protein ligase binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0035033 [histone deacetylase regulator activity] evidence: IEA GeneID:7157 -> Molecular function: GO:0035035 [histone acetyltransferase binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0044212 [transcription regulatory region DNA binding] evidence: IDA GeneID:7157 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IPI GeneID:7157 -> Molecular function: GO:0047485 [protein N-terminus binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0051087 [chaperone binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0051721 [protein phosphatase 2A binding] evidence: IPI GeneID:7157 -> Molecular function: GO:0097371 [MDM2/MDM4 family protein binding] evidence: IEA GeneID:7157 -> Biological process: GO:0000060 [protein import into nucleus, translocation] evidence: IEA GeneID:7157 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IBA GeneID:7157 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IDA GeneID:7157 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: ISS GeneID:7157 -> Biological process: GO:0000733 [DNA strand renaturation] evidence: IDA GeneID:7157 -> Biological process: GO:0001701 [in utero embryonic development] evidence: IEA GeneID:7157 -> Biological process: GO:0001756 [somitogenesis] evidence: IEA GeneID:7157 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IEA GeneID:7157 -> Biological process: GO:0002309 [T cell proliferation involved in immune response] evidence: IEA GeneID:7157 -> Biological process: GO:0002326 [B cell lineage commitment] evidence: IEA GeneID:7157 -> Biological process: GO:0002360 [T cell lineage commitment] evidence: IEA GeneID:7157 -> Biological process: GO:0002931 [response to ischemia] evidence: IEA GeneID:7157 -> Biological process: GO:0006284 [base-excision repair] evidence: TAS GeneID:7157 -> Biological process: GO:0006289 [nucleotide-excision repair] evidence: IMP GeneID:7157 -> Biological process: GO:0006302 [double-strand break repair] evidence: IEA GeneID:7157 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IDA GeneID:7157 -> Biological process: GO:0006461 [protein complex assembly] evidence: IDA GeneID:7157 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA GeneID:7157 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IDA GeneID:7157 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS GeneID:7157 -> Biological process: GO:0006978 [DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator] evidence: IMP GeneID:7157 -> Biological process: GO:0006983 [ER overload response] evidence: IDA GeneID:7157 -> Biological process: GO:0007050 [cell cycle arrest] evidence: IDA GeneID:7157 -> Biological process: GO:0007050 [cell cycle arrest] evidence: IMP GeneID:7157 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: IEA GeneID:7157 -> Biological process: GO:0007265 [Ras protein signal transduction] evidence: IEP GeneID:7157 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IMP GeneID:7157 -> Biological process: GO:0007369 [gastrulation] evidence: IEA GeneID:7157 -> Biological process: GO:0007406 [negative regulation of neuroblast proliferation] evidence: IEA GeneID:7157 -> Biological process: GO:0007417 [central nervous system development] evidence: IEA GeneID:7157 -> Biological process: GO:0007569 [cell aging] evidence: IMP GeneID:7157 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS GeneID:7157 -> Biological process: GO:0008104 [protein localization] evidence: IDA GeneID:7157 -> Biological process: GO:0008156 [negative regulation of DNA replication] evidence: IEA GeneID:7157 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS GeneID:7157 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: ISS GeneID:7157 -> Biological process: GO:0008340 [determination of adult lifespan] evidence: ISS GeneID:7157 -> Biological process: GO:0009303 [rRNA transcription] evidence: IEA GeneID:7157 -> Biological process: GO:0009651 [response to salt stress] evidence: IEA GeneID:7157 -> Biological process: GO:0010165 [response to X-ray] evidence: IBA GeneID:7157 -> Biological process: GO:0010332 [response to gamma radiation] evidence: IMP GeneID:7157 -> Biological process: GO:0010666 [positive regulation of cardiac muscle cell apoptotic process] evidence: IEA GeneID:7157 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA GeneID:7157 -> Biological process: GO:0030154 [cell differentiation] evidence: TAS GeneID:7157 -> Biological process: GO:0030308 [negative regulation of cell growth] evidence: IMP GeneID:7157 -> Biological process: GO:0030330 [DNA damage response, signal transduction by p53 class mediator] evidence: IDA GeneID:7157 -> Biological process: GO:0030330 [DNA damage response, signal transduction by p53 class mediator] evidence: IMP GeneID:7157 -> Biological process: GO:0030512 [negative regulation of transforming growth factor beta receptor signaling pathway] evidence: IEA GeneID:7157 -> Biological process: GO:0031065 [positive regulation of histone deacetylation] evidence: IBA GeneID:7157 -> Biological process: GO:0031497 [chromatin assembly] evidence: IDA GeneID:7157 -> Biological process: GO:0031571 [mitotic G1 DNA damage checkpoint] evidence: IMP GeneID:7157 -> Biological process: GO:0032461 [positive regulation of protein oligomerization] evidence: IDA GeneID:7157 -> Biological process: GO:0033077 [T cell differentiation in thymus] evidence: IEA GeneID:7157 -> Biological process: GO:0034103 [regulation of tissue remodeling] evidence: IEA GeneID:7157 -> Biological process: GO:0034613 [cellular protein localization] evidence: IDA GeneID:7157 -> Biological process: GO:0034644 [cellular response to UV] evidence: IBA GeneID:7157 -> Biological process: GO:0035264 [multicellular organism growth] evidence: IEA GeneID:7157 -> Biological process: GO:0035690 [cellular response to drug] evidence: IEP GeneID:7157 -> Biological process: GO:0042149 [cellular response to glucose starvation] evidence: IDA GeneID:7157 -> Biological process: GO:0042771 [intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator] evidence: IDA GeneID:7157 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: IDA GeneID:7157 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IDA GeneID:7157 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA GeneID:7157 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA GeneID:7157 -> Biological process: GO:0043525 [positive regulation of neuron apoptotic process] evidence: IBA GeneID:7157 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: ISS GeneID:7157 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IDA GeneID:7157 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IMP GeneID:7157 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA GeneID:7157 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IGI GeneID:7157 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IMP GeneID:7157 -> Biological process: GO:0046677 [response to antibiotic] evidence: IEP GeneID:7157 -> Biological process: GO:0046902 [regulation of mitochondrial membrane permeability] evidence: TAS GeneID:7157 -> Biological process: GO:0048147 [negative regulation of fibroblast proliferation] evidence: IMP GeneID:7157 -> Biological process: GO:0050731 [positive regulation of peptidyl-tyrosine phosphorylation] evidence: ISS GeneID:7157 -> Biological process: GO:0051097 [negative regulation of helicase activity] evidence: TAS GeneID:7157 -> Biological process: GO:0051262 [protein tetramerization] evidence: TAS GeneID:7157 -> Biological process: GO:0051402 [neuron apoptotic process] evidence: IEA GeneID:7157 -> Biological process: GO:0070245 [positive regulation of thymocyte apoptotic process] evidence: ISS GeneID:7157 -> Biological process: GO:0071158 [positive regulation of cell cycle arrest] evidence: IMP GeneID:7157 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: IEP GeneID:7157 -> Biological process: GO:0071479 [cellular response to ionizing radiation] evidence: IMP GeneID:7157 -> Biological process: GO:0071850 [mitotic cell cycle arrest] evidence: IEA GeneID:7157 -> Biological process: GO:0072332 [intrinsic apoptotic signaling pathway by p53 class mediator] evidence: IMP GeneID:7157 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IDA GeneID:7157 -> Biological process: GO:0090343 [positive regulation of cell aging] evidence: IEA GeneID:7157 -> Biological process: GO:0090399 [replicative senescence] evidence: IMP GeneID:7157 -> Biological process: GO:0090403 [oxidative stress-induced premature senescence] evidence: IMP GeneID:7157 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:7157 -> Biological process: GO:0097252 [oligodendrocyte apoptotic process] evidence: IDA GeneID:7157 -> Biological process: GO:1901525 [negative regulation of macromitophagy] evidence: IEA GeneID:7157 -> Biological process: GO:2000378 [negative regulation of reactive oxygen species metabolic process] evidence: IEA GeneID:7157 -> Biological process: GO:2000379 [positive regulation of reactive oxygen species metabolic process] evidence: IMP GeneID:7157 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: IMP GeneID:7157 -> Cellular component: GO:0000785 [chromatin] evidence: IBA GeneID:7157 -> Cellular component: GO:0000790 [nuclear chromatin] evidence: IDA GeneID:7157 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:7157 -> Cellular component: GO:0005654 [nucleoplasm] evidence: IDA GeneID:7157 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:7157 -> Cellular component: GO:0005657 [replication fork] evidence: IBA GeneID:7157 -> Cellular component: GO:0005669 [transcription factor TFIID complex] evidence: IDA GeneID:7157 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA GeneID:7157 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:7157 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA GeneID:7157 -> Cellular component: GO:0005759 [mitochondrial matrix] evidence: IEA GeneID:7157 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IEA GeneID:7157 -> Cellular component: GO:0005829 [cytosol] evidence: IBA GeneID:7157 -> Cellular component: GO:0005829 [cytosol] evidence: IDA GeneID:7157 -> Cellular component: GO:0016363 [nuclear matrix] evidence: IDA GeneID:7157 -> Cellular component: GO:0016604 [nuclear body] evidence: IDA GeneID:7157 -> Cellular component: GO:0016605 [PML body] evidence: IDA GeneID:7157 -> Cellular component: GO:0043234 [protein complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.