LOCUS       NM_001123225             442 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens synaptonemal complex central element protein 3
            (SYCE3), mRNA.
ACCESSION   NM_001123225 XM_927380
VERSION     NM_001123225.1  GI:178557812
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 442)
  AUTHORS   Schramm,S., Fraune,J., Naumann,R., Hernandez-Hernandez,A., Hoog,C.,
            Cooke,H.J., Alsheimer,M. and Benavente,R.
  TITLE     A novel mouse synaptonemal complex protein is essential for loading
            of central element proteins, recombination, and fertility
  JOURNAL   PLoS Genet. 7 (5), E1002088 (2011)
   PUBMED   21637789
REFERENCE   2  (bases 1 to 442)
  AUTHORS   Wang,Z.Y., Tong,Q.S., Zeng,F.Q., Liu,Y., Gu,Z.H., Zheng,L.D.,
            Cai,J.B. and Jiang,G.S.
  TITLE     [Cloning and expression of a novel mouse testis gene TSEG-2]
  JOURNAL   Zhonghua Nan Ke Xue 15 (2), 99-105 (2009)
   PUBMED   19323366
  REMARK    GeneRIF: Cloning and expression analysis of a similar gene in
            mouse.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U62317.2.
            On Apr 9, 2008 this sequence version replaced gi:113429475.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: HY000834.1, HY001955.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-42                U62317.2           77555-77596
            43-151              U62317.2           84049-84157
            152-442             U62317.2           89052-89342
FEATURES             Location/Qualifiers
     source          1..442
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="22"
                     /map="22q13.33"
     gene            1..442
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /note="synaptonemal complex central element protein 3"
                     /db_xref="GeneID:644186"
                     /db_xref="HGNC:35245"
     exon            1..42
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /inference="alignment:Splign:1.39.8"
     CDS             43..309
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /note="testis highly expressed gene 2 protein; testis
                     highly expressed protein 2"
                     /codon_start=1
                     /product="synaptonemal complex central element protein 3"
                     /protein_id="NP_001116697.1"
                     /db_xref="GI:178557813"
                     /db_xref="CCDS:CCDS46733.1"
                     /db_xref="GeneID:644186"
                     /db_xref="HGNC:35245"
                     /translation="

MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL

"
     exon            43..151
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(46)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138319189"
     variation       complement(151)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376545270"
     exon            152..442
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(159)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6009990"
     variation       complement(190)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373086990"
     variation       complement(210)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368389026"
     variation       complement(211)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146628983"
     variation       complement(236)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199824322"
     variation       complement(241)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55829948"
     variation       complement(246)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375410166"
     variation       complement(305)
                     /gene="SYCE3"
                     /gene_synonym="C22orf41; THEG2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6009989"
ORIGIN      

tgggggcgccagagcaggaccggagcgcgggccaagctggagatggatgatgctgaccctgaggaaagaaactatgacaacatgctgaaaatgctgtcagatctgaataaggacttggaaaagctattagaagagatggagaaaatctcagtgcaggcgacctggatggcctatgacatggtggtgatgcgcaccaaccctacgctggccgagtccatgcgtcggctggaggatgccttcgtcaactgcaaggaggagatggagaagaactggcaagagctgctgcatgagaccaagcaaaggctgtaggccccactggcccaccacagctgccatgccaccctctgcccgtatgaagaggtcactgggggatggagctggcacccacatgaatagctgtatgcactgtacttgtttcttaataaacttatttttaagcaca

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:644186 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
            GeneID:644186 -> Biological process: GO:0007130 [synaptonemal complex assembly] evidence: ISS
            GeneID:644186 -> Biological process: GO:0007131 [reciprocal meiotic recombination] evidence: ISS
            GeneID:644186 -> Biological process: GO:0007283 [spermatogenesis] evidence: ISS
            GeneID:644186 -> Biological process: GO:0051301 [cell division] evidence: IEA
            GeneID:644186 -> Cellular component: GO:0000801 [central element] evidence: ISS
            GeneID:644186 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
            GeneID:644186 -> Cellular component: GO:0005694 [chromosome] evidence: ISS