Home |
Help |
Advanced search
2024-04-20 14:08:01, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001100400 2745 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens PDS5, regulator of cohesion maintenance, homolog A (S.
cerevisiae) (PDS5A), transcript variant 3, mRNA.
ACCESSION NM_001100400
VERSION NM_001100400.1 GI:155030219
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2745)
AUTHORS Capalbo,G., Muller-Kuller,T., Ottmann,O.G., Hoelzer,D. and
Scheuring,U.J.
TITLE HIV-1 infection suppresses expression of host cell cycle-associated
gene PDS5A
JOURNAL Intervirology 55 (4), 263-275 (2012)
PUBMED 21865657
REMARK GeneRIF: The data show a downregulation of proliferation-associated
host gene PDS5A and suggest a role of PDS5A in HIV-1-induced
cellular pathogenesis but not viral replication.
REFERENCE 2 (bases 1 to 2745)
AUTHORS Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M.,
Toyama,S., Usami,R., Ohtoko,K. and Kato,S.
TITLE Full-length transcriptome analysis of human retina-derived cell
lines ARPE-19 and Y79 using the vector-capping method
JOURNAL Invest. Ophthalmol. Vis. Sci. 52 (9), 6662-6670 (2011)
PUBMED 21697133
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2745)
AUTHORS Hagemann,C., Weigelin,B., Schommer,S., Schulze,M., Al-Jomah,N.,
Anacker,J., Gerngras,S., Kuhnel,S., Kessler,A.F., Polat,B.,
Ernestus,R.I., Patel,R. and Vince,G.H.
TITLE The cohesin-interacting protein, precocious dissociation of sisters
5A/sister chromatid cohesion protein 112, is up-regulated in human
astrocytic tumors
JOURNAL Int. J. Mol. Med. 27 (1), 39-51 (2011)
PUBMED 21069257
REMARK GeneRIF: Data show that the siRNA-mediated knockdown of Pds5A
affects sister chromatid cohesion but does not influence mitotic
checkpoint function or the proliferation and survival of
glioblastoma multiforme cells.
REFERENCE 4 (bases 1 to 2745)
AUTHORS Terret,M.E., Sherwood,R., Rahman,S., Qin,J. and Jallepalli,P.V.
TITLE Cohesin acetylation speeds the replication fork
JOURNAL Nature 462 (7270), 231-234 (2009)
PUBMED 19907496
REFERENCE 5 (bases 1 to 2745)
AUTHORS Zhang,H., Liu,Y., Wang,Y., Li,G., Luo,Z., Jiang,Pf., Li,F., Wang,S.
and Deng,K.
TITLE [Analysis of deafness gene mutations by gene chip and its clinical
significance]
JOURNAL Lin Chung Er Bi Yan Hou Tou Jing Wai Ke Za Zhi 23 (22), 1032-1035
(2009)
PUBMED 20359100
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 6 (bases 1 to 2745)
AUTHORS Losada,A., Yokochi,T. and Hirano,T.
TITLE Functional contribution of Pds5 to cohesin-mediated cohesion in
human cells and Xenopus egg extracts
JOURNAL J. Cell. Sci. 118 (PT 10), 2133-2141 (2005)
PUBMED 15855230
REFERENCE 7 (bases 1 to 2745)
AUTHORS Rankin,S., Ayad,N.G. and Kirschner,M.W.
TITLE Sororin, a substrate of the anaphase-promoting complex, is required
for sister chromatid cohesion in vertebrates
JOURNAL Mol. Cell 18 (2), 185-200 (2005)
PUBMED 15837422
REMARK Erratum:[Mol Cell. 2005 May 27;18(5):609]
REFERENCE 8 (bases 1 to 2745)
AUTHORS Kumar,D., Sakabe,I., Patel,S., Zhang,Y., Ahmad,I., Gehan,E.A.,
Whiteside,T.L. and Kasid,U.
TITLE SCC-112, a novel cell cycle-regulated molecule, exhibits reduced
expression in human renal carcinomas
JOURNAL Gene 328, 187-196 (2004)
PUBMED 15019998
REMARK GeneRIF: Findings suggest that the SCC-112 gene expression is
likely to be associated with normal cell growth and proliferation.
REFERENCE 9 (bases 1 to 2745)
AUTHORS Gregson,H.C., Schmiesing,J.A., Kim,J.S., Kobayashi,T., Zhou,S. and
Yokomori,K.
TITLE A potential role for human cohesin in mitotic spindle aster
assembly
JOURNAL J. Biol. Chem. 276 (50), 47575-47582 (2001)
PUBMED 11590136
REFERENCE 10 (bases 1 to 2745)
AUTHORS Sumara,I., Vorlaufer,E., Gieffers,C., Peters,B.H. and Peters,J.M.
TITLE Characterization of vertebrate cohesin complexes and their
regulation in prophase
JOURNAL J. Cell Biol. 151 (4), 749-762 (2000)
PUBMED 11076961
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC041361.1, AC098591.4 and
CA412233.1.
Summary: The protein encoded by this gene binds to the cohesin
complex and associates with chromatin through most of the cell
cycle. The encoded protein may play a role in regulating sister
chromatid cohesion during mitosis. Two transcript variants encoding
different isoforms have been found for this gene. [provided by
RefSeq, May 2010].
Transcript Variant: This variant (3) differs in the 3' UTR and
lacks several exons in the 3' coding region, compared to variant 1.
The resulting protein (isoform 3) has a distinct C-terminus and is
shorter than isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC041361.1, AK098331.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-92 BC041361.1 5-96
93-93 AC098591.4 27340-27340 c
94-2685 BC041361.1 98-2689
2686-2745 CA412233.1 1-60 c
FEATURES Location/Qualifiers
source 1..2745
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="4"
/map="4p14"
gene 1..2745
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/note="PDS5, regulator of cohesion maintenance, homolog A
(S. cerevisiae)"
/db_xref="GeneID:23244"
/db_xref="HGNC:29088"
/db_xref="MIM:613200"
exon 1..500
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(20)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:145155667"
variation complement(34)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="c"
/db_xref="dbSNP:112400722"
variation complement(93)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="g"
/db_xref="dbSNP:537353"
variation complement(134)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="g"
/replace="t"
/db_xref="dbSNP:141371954"
variation complement(294)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:146606833"
variation complement(396..397)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace=""
/replace="cgg"
/db_xref="dbSNP:377504888"
exon 501..678
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
misc_feature 508..510
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/note="upstream in-frame stop codon"
CDS 541..2343
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/note="isoform 3 is encoded by transcript variant 3;
sister chromatid cohesion protein PDS5 homolog A; sister
chromatid cohesion protein 112; cell
proliferation-inducing gene 54 protein"
/codon_start=1
/product="sister chromatid cohesion protein PDS5 homolog A
isoform 3"
/protein_id="NP_001093870.1"
/db_xref="GI:155030220"
/db_xref="CCDS:CCDS54759.1"
/db_xref="GeneID:23244"
/db_xref="HGNC:29088"
/db_xref="MIM:613200"
/translation="
MDFTAQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSEDEKQQYLPLALHLASEFFLRNPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFITRQLKGLEDTKSPQFNRYFYLLENLAWVKSYNICFELEDCNEIFIQLFRTLFSVINNSHNKKVQMHMLDLMSSIIMEGDGVTQELLDSILINLIPAHKNLNKQSFDLAKVLLKRTVQTIEACIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPHLLLSVMPQLEFKLKSNDGEERLAVVRLLAKLFGSKDSDLATQNRPLWQCFLGRFNDIHVPVRLESVKFASHCLMNHPDLAKDLTEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRWRVRKEAMMGLAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLETEERMKCLYYLYASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLMTIAKNLPDPGKAQDFVKKFNQVLGDDEKLRSQLELLISPTCSCKQADICVVSKSYFTLFL
"
misc_feature 1717..1827
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q29RF7.1);
Region: HEAT"
variation complement(588)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:201306746"
variation complement(621)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:370276475"
variation complement(626)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="g"
/replace="t"
/db_xref="dbSNP:200892073"
variation complement(678)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:183378231"
exon 679..882
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(693)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:373191152"
variation complement(735)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:190572121"
variation complement(741)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:368687516"
variation complement(799)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="c"
/db_xref="dbSNP:201833974"
variation complement(813)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:376578280"
variation complement(863)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="g"
/db_xref="dbSNP:372683118"
variation complement(866)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="g"
/db_xref="dbSNP:369934532"
exon 883..969
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(948)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:376404493"
exon 970..1067
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(996)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:191005753"
variation complement(1065)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="c"
/db_xref="dbSNP:186207164"
exon 1068..1194
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(1068)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="c"
/db_xref="dbSNP:77620225"
variation complement(1120)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:367619204"
exon 1195..1275
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(1207)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="g"
/db_xref="dbSNP:370920956"
variation complement(1233)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:377653620"
variation complement(1245)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:373483596"
variation complement(1257)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:369262263"
variation complement(1272)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:28449663"
exon 1276..1416
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(1363)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:372684647"
exon 1417..1532
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(1437)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="c"
/db_xref="dbSNP:375996043"
variation complement(1446)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:199880029"
variation complement(1467)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:372830403"
variation complement(1506)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:368201880"
variation complement(1518)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:375216497"
exon 1533..1627
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(1614)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:187463902"
exon 1628..1773
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
exon 1774..1925
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(1847)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:34748316"
variation complement(1865)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:370580689"
exon 1926..2039
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(1965)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="g"
/db_xref="dbSNP:376993510"
variation complement(2035)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:373353572"
exon 2040..2121
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(2091)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:372011026"
variation complement(2097)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:375379716"
exon 2122..2170
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
exon 2171..2728
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/inference="alignment:Splign:1.39.8"
variation complement(2229)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:200394020"
variation complement(2249)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:185272845"
variation complement(2278)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:193075238"
variation complement(2317)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:371095912"
variation complement(2340)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="g"
/db_xref="dbSNP:73229703"
variation complement(2361)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:188136425"
variation complement(2441)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:376934899"
STS 2510..2659
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/standard_name="STS-R02821"
/db_xref="UniSTS:70078"
variation complement(2518)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:377750753"
variation complement(2521)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:115313226"
variation complement(2554)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="c"
/replace="t"
/db_xref="dbSNP:182513173"
variation complement(2634)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace="a"
/replace="g"
/db_xref="dbSNP:191290043"
polyA_signal 2659..2664
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
variation complement(2672..2674)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace=""
/replace="tag"
/db_xref="dbSNP:377387114"
variation complement(2674..2676)
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
/replace=""
/replace="gta"
/db_xref="dbSNP:143322658"
polyA_site 2681
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
polyA_site 2728
/gene="PDS5A"
/gene_synonym="PIG54; SCC-112; SCC112"
ORIGIN
ggccggcggaggaaggggagggagcgaggagcgcgcgctgctctcgcgtgctctcgcgccgctcgcgtgaccggccggtgtgtgcgcgaggccccggctcccggggcacggacggccgggcgcgcgcctctgcgaggggcgtccgggtccgagtcggcggtccgggccggcgcgaggtgcgtgcgggcgggccgcgggggtcccggacggacacaagcgcacacactcccggaggagccttcgaggctgctcttcctcggccagacggagagcggcactgtctccccgcccagcgctcactcgccccgcgtctccccccgcggcggctgctcctcctcggcaccgccagccccagcgccgctcccgggcgggcgggcggcggcggcggcggcggcgggacccgcggagccgctttgtgtgcagcccgactaggggcggcggcgcaaccacctgacagaggcccgggcgctcgatgcaccttccgcccgcatgaggaggagaggccggtagaggactgtgaaccaaaagttgtcccccaggatggacttcaccgcgcagcccaagcctgccactgccctctgtggcgtcgtgagtgccgacgggaagatcgcttaccctccgggggtaaaagagatcaccgacaagatcaccacggacgagatgatcaaacgcctgaagatggtagtgaaaacctttatggatatggatcaggactcagaagatgaaaaacagcagtatctcccactagccttgcatcttgcatctgaattcttcctcaggaaccccaataaagatgtgcgtctccttgtagcatgttgtttggctgatatctttcgtatctatgccccagaagctccatatacttcccatgataaacttaaggacatatttttgtttattaccagacaattaaaaggtttggaggatacaaagagtccacagtttaatagatacttttatttattagagaatttagcttgggttaaatcatataacatctgctttgaattggaagattgcaatgaaatttttattcagctttttagaactctcttctcagtgatcaacaatagccacaataagaaggtacaaatgcacatgctagatttgatgagttctatcatcatggaaggtgatggagttactcaagaattattggactccattcttattaacctcattcctgcacataagaacttaaataaacagtcctttgaccttgcaaaagtgctattgaaaagaacagtccagactattgaggcatgcattgctaattttttcaatcaagtcctggtgctgggaagatcatcagtaagtgatttgtcagaacatgtatttgatctgattcaggaactttttgctatagatcctcatttattattatccgtcatgccacagcttgaattcaaactaaagagcaatgatggagaagagcgattagctgttgttcgacttctagctaaattgtttggctccaaagattctgatttggcaacacagaatcgtcctctttggcaatgttttcttggacgatttaatgatattcatgttcctgtgagattagaaagtgtgaaatttgccagtcattgtttaatgaatcacccagatttagcgaaggatctcacagaatatttaaaggttagatcacatgatccagaagaagctattcgtcatgatgtcattgttactataataacagctgccaagagggacctggccttagtaaatgatcagctgcttggctttgtaagggaaagaacactggataaacggtggcgagtaagaaaagaagctatgatgggtctggctcagctttataagaaatactgtcttcatggtgaagcaggaaaggaagctgcagagaaagtcagctggataaaggacaaacttctgcatatttattatcagaacagcattgacgacaaactgttggtagagaaaatctttgctcagtatcttgtcccccacaacctggaaacagaagagagaatgaaatgcttatattacttatatgctagtttggatccaaatgctgtaaaagctctcaacgaaatgtggaagtgtcagaacatgcttcggagccatgtacgcgaactattggatttgcacaagcagcctacatcagaggctaactgttctgccatgtttggaaaactgatgaccatagcaaagaatttgcctgaccccgggaaagcacaagattttgtgaagaaatttaaccaggttctcggcgatgatgagaaacttcggtctcagttggagttattaattagcccaacctgttcttgcaaacaagcagatatttgtgtggttagtaaatcatacttcacactttttctctagctttacttacagaaatatgtattttattaaagcctgttttacatacagtgatttgtgtaaatgtaacaatattgtgagctctgaattactttggagtatatctattgtcaagttaattctctatttaccattcactctcagccacattccaggaaaataactaaagaactaagccagggagattggtcttaggaattttacaagataaagtactttgaacttagtagacattcattgagtaatgataagtattttctgaatgcttgtgtacatgtgcattttcttctttcatgtattagaatggaaataatcgtcaataaattagtagtagtaacattgccatatatctggtttcatttacagataaagtaaattcctatctagaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:23244 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:23244 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:23244 -> Biological process: GO:0000910 [cytokinesis] evidence: TAS
GeneID:23244 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:23244 -> Biological process: GO:0008156 [negative regulation of DNA replication] evidence: IMP
GeneID:23244 -> Cellular component: GO:0000775 [chromosome, centromeric region] evidence: TAS
GeneID:23244 -> Cellular component: GO:0000785 [chromatin] evidence: IDA
GeneID:23244 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:23244 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:23244 -> Cellular component: GO:0005694 [chromosome] evidence: TAS
GeneID:23244 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
GeneID:23244 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:23244 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.