GGRNA Home | Help | Advanced search

2019-03-24 19:52:23, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001100168            3451 bp    mRNA    linear   PRI 15-JUL-2013
DEFINITION  Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene)
            (CCR5), transcript variant B, mRNA.
ACCESSION   NM_001100168
VERSION     NM_001100168.1  GI:154091327
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3451)
  AUTHORS   Steen,A., Thiele,S., Guo,D., Hansen,L.S., Frimurer,T.M. and
            Rosenkilde,M.M.
  TITLE     Biased and constitutive signaling in the CC-chemokine receptor CCR5
            by manipulating the interface between transmembrane helices 6 and 7
  JOURNAL   J. Biol. Chem. 288 (18), 12511-12521 (2013)
   PUBMED   23493400
  REMARK    GeneRIF: These results provide important information on the
            molecular interplay and impact of TM6 and TM7 for CCR5 activity,
            which may be extrapolated to other chemokine receptors and possibly
            to other 7TM receptors.
REFERENCE   2  (bases 1 to 3451)
  AUTHORS   Schnur,E., Kessler,N., Zherdev,Y., Noah,E., Scherf,T., Ding,F.X.,
            Rabinovich,S., Arshava,B., Kurbatska,V., Leonciks,A., Tsimanis,A.,
            Rosen,O., Naider,F. and Anglister,J.
  TITLE     NMR mapping of RANTES surfaces interacting with CCR5 using linked
            extracellular domains
  JOURNAL   FEBS J. 280 (9), 2068-2084 (2013)
   PUBMED   23480650
  REMARK    GeneRIF: N-terminal-CCR5 and extracellular loop 2 are the major
            contributors to CCR5 binding to RANTES.
REFERENCE   3  (bases 1 to 3451)
  AUTHORS   Bjorkander,S., Heidari-Hamedani,G., Bremme,K., Gunnarsson,I. and
            Holmlund,U.
  TITLE     Peripheral monocyte expression of the chemokine receptors CCR2,
            CCR5 and CXCR3 is altered at parturition in healthy women and in
            women with systemic lupus erythematosus
  JOURNAL   Scand. J. Immunol. 77 (3), 200-212 (2013)
   PUBMED   23298254
  REMARK    GeneRIF: Data indicate that women with systemic lupus erythematosus
            (SLE) responded similar to pregnancy as did healthy women with
            lower percentages of CCR2+, CCR5+ and CXCR3+ monocytes.
REFERENCE   4  (bases 1 to 3451)
  AUTHORS   de Voux,A., Chan,M.C., Folefoc,A.T., Madziva,M.T. and Flanagan,C.A.
  TITLE     Constitutively active CCR5 chemokine receptors differ in mediating
            HIV envelope-dependent fusion
  JOURNAL   PLoS ONE 8 (1), E54532 (2013)
   PUBMED   23355876
  REMARK    GeneRIF: Constitutively active CCR5 chemokine receptors differ in
            mediating HIV envelope-dependent fusion.
REFERENCE   5  (bases 1 to 3451)
  AUTHORS   Ivanoshchuk,D.E., Mikhailova,S.V., Kulikov,I.V., Maksimov,V.N.,
            Voevoda,M.I. and Romashchenko,A.G.
  TITLE     [CCR5, CCR2, apoe, p53, ITGB3 and HFE gene polymorphism in Western
            Siberia long-livers]
  JOURNAL   Adv Gerontol 25 (3), 394-397 (2012)
   PUBMED   23289212
  REMARK    GeneRIF: carriage of the delta32 polymorphism for the CCR5 gene,
            does not influence on predisposition to the longevity.
REFERENCE   6  (bases 1 to 3451)
  AUTHORS   Madsen,H.O., Poulsen,K., Dahl,O., Clark,B.F. and Hjorth,J.P.
  TITLE     Retropseudogenes constitute the major part of the human elongation
            factor 1 alpha gene family
  JOURNAL   Nucleic Acids Res. 18 (6), 1513-1516 (1990)
   PUBMED   2183196
REFERENCE   7  (bases 1 to 3451)
  AUTHORS   Whiteheart,S.W., Shenbagamurthi,P., Chen,L., Cotter,R.J. and
            Hart,G.W.
  TITLE     Murine elongation factor 1 alpha (EF-1 alpha) is
            posttranslationally modified by novel amide-linked
            ethanolamine-phosphoglycerol moieties. Addition of
            ethanolamine-phosphoglycerol to specific glutamic acid residues on
            EF-1 alpha
  JOURNAL   J. Biol. Chem. 264 (24), 14334-14341 (1989)
   PUBMED   2569467
REFERENCE   8  (bases 1 to 3451)
  AUTHORS   Uetsuki,T., Naito,A., Nagata,S. and Kaziro,Y.
  TITLE     Isolation and characterization of the human chromosomal gene for
            polypeptide chain elongation factor-1 alpha
  JOURNAL   J. Biol. Chem. 264 (10), 5791-5798 (1989)
   PUBMED   2564392
REFERENCE   9  (bases 1 to 3451)
  AUTHORS   Itoh,H., Toyama,R., Kozasa,T., Tsukamoto,T., Matsuoka,M. and
            Kaziro,Y.
  TITLE     Presence of three distinct molecular species of Gi protein alpha
            subunit. Structure of rat cDNAs and human genomic DNAs
  JOURNAL   J. Biol. Chem. 263 (14), 6656-6664 (1988)
   PUBMED   2834384
REFERENCE   10 (bases 1 to 3451)
  AUTHORS   Ann,D.K., Wu,M.M., Huang,T., Carlson,D.M. and Wu,R.
  TITLE     Retinol-regulated gene expression in human tracheobronchial
            epithelial cells. Enhanced expression of elongation factor EF-1
            alpha
  JOURNAL   J. Biol. Chem. 263 (8), 3546-3549 (1988)
   PUBMED   3346208
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC098613.2, DA818906.1,
            U54994.1 and BC038398.1.
            
            Summary: This gene encodes a member of the beta chemokine receptor
            family, which is predicted to be a seven transmembrane protein
            similar to G protein-coupled receptors. This protein is expressed
            by T cells and macrophages, and is known to be an important
            co-receptor for macrophage-tropic virus, including HIV, to enter
            host cells. Defective alleles of this gene have been associated
            with the HIV infection resistance. The ligands of this receptor
            include monocyte chemoattractant protein 2 (MCP-2), macrophage
            inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory
            protein 1 beta (MIP-1 beta) and regulated on activation normal T
            expressed and secreted protein (RANTES). Expression of this gene
            was also detected in a promyeloblastic cell line, suggesting that
            this protein may play a role in granulocyte lineage proliferation
            and differentiation. This gene is located at the chemokine receptor
            gene cluster region. Two transcript variants encoding the same
            protein have been found for this gene. [provided by RefSeq, Jul
            2008].
            
            Transcript Variant: This variant (B) differs in the 5' UTR compared
            to variant A. Both variants encode the same protein.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data because no single transcript was available
            for the full length of the gene. The extent of this transcript is
            supported by published experimental evidence.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            CDS exon combination :: U54994.1, BC038398.1 [ECO:0000331]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-57                AC098613.2         26671-26727
            58-532              DA818906.1         82-556
            533-2198            U54994.1           465-2130
            2199-2899           BC038398.1         2120-2820
            2900-3040           U54994.1           2832-2972
            3041-3451           BC038398.1         2962-3372
FEATURES             Location/Qualifiers
     source          1..3451
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3p21.31"
     gene            1..3451
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /note="chemokine (C-C motif) receptor 5 (gene/pseudogene)"
                     /db_xref="GeneID:1234"
                     /db_xref="HGNC:1606"
                     /db_xref="MIM:601373"
     exon            1..57
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="alignment:Splign:1.39.8"
     variation       29
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2856758"
     variation       43
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2856759"
     misc_feature    54..56
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /note="upstream in-frame stop codon"
     exon            58..111
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="alignment:Splign:1.39.8"
     exon            112..3426
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="alignment:Splign:1.39.8"
     variation       113
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:184985767"
     CDS             123..1181
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /note="chemr13; C-C motif chemokine receptor 5 A159A;
                     chemokine receptor CCR5; HIV-1 fusion coreceptor"
                     /codon_start=1
                     /product="C-C chemokine receptor type 5"
                     /protein_id="NP_001093638.1"
                     /db_xref="GI:154091328"
                     /db_xref="CCDS:CCDS2739.1"
                     /db_xref="GeneID:1234"
                     /db_xref="HGNC:1606"
                     /db_xref="MIM:601373"
                     /translation="
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
"
     misc_feature    129..131
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Sulfotyrosine; propagated from UniProtKB/Swiss-Prot
                     (P51681.1); sulfatation site"
     misc_feature    150..152
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Sulfotyrosine; propagated from UniProtKB/Swiss-Prot
                     (P51681.1); sulfatation site"
     misc_feature    159..1103
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /note="chemokine receptor-like protein; Provisional;
                     Region: PHA02834"
                     /db_xref="CDD:165177"
     misc_feature    162..164
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Sulfotyrosine; propagated from UniProtKB/Swiss-Prot
                     (P51681.1); sulfatation site"
     misc_feature    213..296
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    327..389
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    429..494
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    546..620
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    717..776
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    828..902
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    954..1025
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    1128..1130
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by BARK1; propagated from
                     UniProtKB/Swiss-Prot (P51681.1); phosphorylation site"
     misc_feature    1131..1133
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by BARK1; propagated from
                     UniProtKB/Swiss-Prot (P51681.1); phosphorylation site"
     misc_feature    1146..1148
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by BARK1; propagated from
                     UniProtKB/Swiss-Prot (P51681.1); phosphorylation site"
     misc_feature    1167..1169
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by BARK1; propagated from
                     UniProtKB/Swiss-Prot (P51681.1); phosphorylation site"
     variation       165
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200209014"
     variation       172
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369206494"
     variation       174
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142904831"
     variation       180
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145061115"
     variation       199
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189601230"
     variation       207
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800939"
     variation       214
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56340326"
     variation       216
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374426321"
     variation       227
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113471490"
     variation       258
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41425744"
     variation       286
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1799863"
     variation       287
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148106779"
     variation       302
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800940"
     variation       309
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142829420"
     variation       322
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199722561"
     variation       338
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143880323"
     variation       340
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56198941"
     variation       347
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800941"
     variation       399
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376364792"
     variation       405
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149975182"
     variation       425
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1800560"
     variation       431
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:56068070"
     variation       438
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183662584"
     variation       441
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138174483"
     variation       460
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200815713"
     variation       480
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370409212"
     variation       482
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200108729"
     variation       484
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150497029"
     variation       494
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138380934"
     variation       495
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146209111"
     variation       504
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201179081"
     variation       513
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:34418657"
     variation       544
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371901382"
     variation       599
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55639502"
     variation       614
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1800942"
     variation       616
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372054532"
     variation       628
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376687230"
     variation       637
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377330713"
     variation       653
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369351284"
     variation       654
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199824195"
     variation       676..707
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace=""
                     /replace="gtcagtatcaattctggaagaatttccagaca"
                     /db_xref="dbSNP:333"
     variation       676
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:112590754"
     variation       677
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111718604"
     variation       678
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:113869679"
     variation       682
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372782701"
     variation       690
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201797884"
     variation       697
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:199827265"
     variation       701
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:56345960"
     variation       704
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:62625034"
     STS             730..1159
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /standard_name="D3S4504"
                     /db_xref="UniSTS:474434"
     variation       739
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113552054"
     variation       740
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139737901"
     variation       767
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376137306"
     variation       769
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371598347"
     variation       781
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151126808"
     variation       788
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201290940"
     variation       789
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200419576"
     variation       790
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1800452"
     variation       795
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146972949"
     variation       800
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373358134"
     variation       822
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371621013"
     variation       827
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147615392"
     variation       841
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199780106"
     variation       844
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201301850"
     variation       859
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143181119"
     variation       863
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141139165"
     variation       881
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367851873"
     variation       892
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142469507"
     variation       928
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184279915"
     variation       946
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:112762802"
     STS             959..1142
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /standard_name="RH65248"
                     /db_xref="UniSTS:88902"
     variation       961
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374495269"
     STS             971..1147
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /standard_name="STS-X91492"
                     /db_xref="UniSTS:43626"
     variation       982
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:55956105"
     variation       984
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150592242"
     variation       986
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372879037"
     variation       989
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149622978"
     variation       993
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200740810"
     variation       996
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375777270"
     variation       1004
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368391698"
     variation       1023
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55916127"
     variation       1024
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800943"
     variation       1067
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371813238"
     variation       1074
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188772198"
     variation       1077
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374959868"
     variation       1078
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369373756"
     variation       1106
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372786661"
     variation       1110..1111
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34962689"
     variation       1112
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35853487"
     variation       1113
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199846907"
     variation       1115
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201780857"
     variation       1118
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148802293"
     variation       1122
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147879075"
     variation       1126
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800944"
     variation       1138
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1800945"
     variation       1153
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375916464"
     variation       1160
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2157060"
     variation       1184
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191297617"
     variation       1293
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146080174"
     variation       1375
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112622745"
     variation       1418
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183840358"
     variation       1471
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:41414147"
     variation       1544
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143589063"
     variation       1680
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369515918"
     variation       1801
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145725153"
     variation       1833
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373926603"
     variation       1874
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41495153"
     variation       1880
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142957506"
     variation       1898
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151122728"
     variation       1918
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375306827"
     variation       1945
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17765882"
     variation       1965
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41418945"
     variation       1968
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41466044"
     variation       1990
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190456231"
     variation       2125
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41345848"
     variation       2127
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141257116"
     variation       2151
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200501663"
     variation       2167
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201290180"
     variation       2171
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199648605"
     variation       2199
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800874"
     variation       2209
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200364389"
     variation       2225
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201423367"
     variation       2237
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186889269"
     variation       2272
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146926765"
     variation       2327
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:137866928"
     variation       2347
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41535253"
     variation       2415
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41526948"
     variation       2427
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77024144"
     variation       2579
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201417500"
     variation       2580
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3188094"
     variation       2584
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190094030"
     variation       2608
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181602248"
     variation       2612
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185327310"
     variation       2694
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1048115"
     variation       2787
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:141737357"
     variation       2798
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:41442546"
     variation       2895
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190136403"
     variation       2901
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376306118"
     variation       2953
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182052831"
     variation       2960
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:41512547"
     variation       3041
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746492"
     variation       3043
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200688955"
     variation       3055
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186138215"
     variation       3069
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:192256035"
     variation       3211
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184040468"
     variation       3227
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370386700"
     variation       3254
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188577829"
     variation       3299
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374785441"
     polyA_signal    3403..3408
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
     polyA_site      3426
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
ORIGIN      
cttcagatagattatatctggagtgaagaatcctgccacctatgtatctggcatagtctcatctggccagaagagctgagacatccgttcccctacaagaaactctccccgggtggaacaagatggattatcaagtgtcaagtccaatctatgacatcaattattatacatcggagccctgccaaaaaatcaatgtgaagcaaatcgcagcccgcctcctgcctccgctctactcactggtgttcatctttggttttgtgggcaacatgctggtcatcctcatcctgataaactgcaaaaggctgaagagcatgactgacatctacctgctcaacctggccatctctgacctgtttttccttcttactgtccccttctgggctcactatgctgccgcccagtgggactttggaaatacaatgtgtcaactcttgacagggctctattttataggcttcttctctggaatcttcttcatcatcctcctgacaatcgataggtacctggctgtcgtccatgctgtgtttgctttaaaagccaggacggtcacctttggggtggtgacaagtgtgatcacttgggtggtggctgtgtttgcgtctctcccaggaatcatctttaccagatctcaaaaagaaggtcttcattacacctgcagctctcattttccatacagtcagtatcaattctggaagaatttccagacattaaagatagtcatcttggggctggtcctgccgctgcttgtcatggtcatctgctactcgggaatcctaaaaactctgcttcggtgtcgaaatgagaagaagaggcacagggctgtgaggcttatcttcaccatcatgattgtttattttctcttctgggctccctacaacattgtccttctcctgaacaccttccaggaattctttggcctgaataattgcagtagctctaacaggttggaccaagctatgcaggtgacagagactcttgggatgacgcactgctgcatcaaccccatcatctatgcctttgtcggggagaagttcagaaactacctcttagtcttcttccaaaagcacattgccaaacgcttctgcaaatgctgttctattttccagcaagaggctcccgagcgagcaagctcagtttacacccgatccactggggagcaggaaatatctgtgggcttgtgacacggactcaagtgggctggtgacccagtcagagttgtgcacatggcttagttttcatacacagcctgggctgggggtggggtgggagaggtcttttttaaaaggaagttactgttatagagggtctaagattcatccatttatttggcatctgtttaaagtagattagatcttttaagcccatcaattatagaaagccaaatcaaaatatgttgatgaaaaatagcaacctttttatctccccttcacatgcatcaagttattgacaaactctcccttcactccgaaagttccttatgtatatttaaaagaaagcctcagagaattgctgattcttgagtttagtgatctgaacagaaataccaaaattatttcagaaatgtacaactttttacctagtacaaggcaacatataggttgtaaatgtgtttaaaacaggtctttgtcttgctatggggagaaaagacatgaatatgattagtaaagaaatgacacttttcatgtgtgatttcccctccaaggtatggttaataagtttcactgacttagaaccaggcgagagacttgtggcctgggagagctggggaagcttcttaaatgagaaggaatttgagttggatcatctattgctggcaaagacagaagcctcactgcaagcactgcatgggcaagcttggctgtagaaggagacagagctggttgggaagacatggggaggaaggacaaggctagatcatgaagaaccttgacggcattgctccgtctaagtcatgagctgagcagggagatcctggttggtgttgcagaaggtttactctgtggccaaaggagggtcaggaaggatgagcatttagggcaaggagaccaccaacagccctcaggtcagggtgaggatggcctctgctaagctcaaggcgtgaggatgggaaggagggaggtattcgtaaggatgggaaggagggaggtattcgtgcagcatatgaggatgcagagtcagcagaactggggtggatttgggttggaagtgagggtcagagaggagtcagagagaatccctagtcttcaagcagattggagaaacccttgaaaagacatcaagcacagaaggaggaggaggaggtttaggtcaagaagaagatggattggtgtaaaaggatgggtctggtttgcagagcttgaacacagtctcacccagactccaggctgtctttcactgaatgcttctgacttcatagatttccttcccatcccagctgaaatactgaggggtctccaggaggagactagatttatgaatacacgaggtatgaggtctaggaacatacttcagctcacacatgagatctaggtgaggattgattacctagtagtcatttcatgggttgttgggaggattctatgaggcaaccacaggcagcatttagcacatactacacattcaataagcatcaaactcttagttactcattcagggatagcactgagcaaagcattgagcaaaggggtcccatagaggtgagggaagcctgaaaaactaagatgctgcctgcccagtgcacacaagtgtaggtatcattttctgcatttaaccgtcaataggcaaaggggggaagggacatattcatttggaaataagctgccttgagccttaaaacccacaaaagtacaatttaccagcctccgtatttcagactgaatgggggtggggggggcgccttaggtacttattccagatgccttctccagacaaaccagaagcaacagaaaaaatcgtctctccctccctttgaaatgaatataccccttagtgtttgggtatattcatttcaaagggagagagagaggtttttttctgttctgtctcatatgattgtgcacatacttgagactgttttgaatttgggggatggctaaaaccatcatagtacaggtaaggtgagggaatagtaagtggtgagaactactcagggaatgaaggtgtcagaataataagaggtgctactgactttctcagcctctgaatatgaacggtgagcattgtggctgtcagcaggaagcaacgaagggaaatgtctttccttttgctcttaagttgtggagagtgcaacagtagcataggaccctaccctctgggccaagtcaaagacattctgacatcttagtatttgcatattcttatgtatgtgaaagttacaaattgcttgaaagaaaatatgcatctaataaaaaacaccttctaaaataaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1234 -> Molecular function: GO:0003779 [actin binding] evidence: IDA
            GeneID:1234 -> Molecular function: GO:0004435 [phosphatidylinositol phospholipase C activity] evidence: TAS
            GeneID:1234 -> Molecular function: GO:0004950 [chemokine receptor activity] evidence: TAS
            GeneID:1234 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:1234 -> Molecular function: GO:0015026 [coreceptor activity] evidence: TAS
            GeneID:1234 -> Molecular function: GO:0016493 [C-C chemokine receptor activity] evidence: IDA
            GeneID:1234 -> Molecular function: GO:0016493 [C-C chemokine receptor activity] evidence: NAS
            GeneID:1234 -> Molecular function: GO:0019957 [C-C chemokine binding] evidence: IPI
            GeneID:1234 -> Molecular function: GO:0071791 [chemokine (C-C motif) ligand 5 binding] evidence: IPI
            GeneID:1234 -> Biological process: GO:0000165 [MAPK cascade] evidence: IEP
            GeneID:1234 -> Biological process: GO:0002407 [dendritic cell chemotaxis] evidence: TAS
            GeneID:1234 -> Biological process: GO:0006816 [calcium ion transport] evidence: IDA
            GeneID:1234 -> Biological process: GO:0006935 [chemotaxis] evidence: TAS
            GeneID:1234 -> Biological process: GO:0006954 [inflammatory response] evidence: IEA
            GeneID:1234 -> Biological process: GO:0006955 [immune response] evidence: IEA
            GeneID:1234 -> Biological process: GO:0006968 [cellular defense response] evidence: TAS
            GeneID:1234 -> Biological process: GO:0007166 [cell surface receptor signaling pathway] evidence: TAS
            GeneID:1234 -> Biological process: GO:0007186 [G-protein coupled receptor signaling pathway] evidence: IMP
            GeneID:1234 -> Biological process: GO:0007204 [elevation of cytosolic calcium ion concentration] evidence: TAS
            GeneID:1234 -> Biological process: GO:0007267 [cell-cell signaling] evidence: IDA
            GeneID:1234 -> Biological process: GO:0014808 [release of sequestered calcium ion into cytosol by sarcoplasmic reticulum] evidence: IDA
            GeneID:1234 -> Biological process: GO:0016032 [viral process] evidence: TAS
            GeneID:1234 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
            GeneID:1234 -> Biological process: GO:0019722 [calcium-mediated signaling] evidence: IDA
            GeneID:1234 -> Biological process: GO:0023052 [signaling] evidence: IEP
            GeneID:1234 -> Biological process: GO:0030260 [entry into host cell] evidence: TAS
            GeneID:1234 -> Biological process: GO:0070098 [chemokine-mediated signaling pathway] evidence: TAS
            GeneID:1234 -> Biological process: GO:0070723 [response to cholesterol] evidence: IMP
            GeneID:1234 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IEP
            GeneID:1234 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
            GeneID:1234 -> Cellular component: GO:0005768 [endosome] evidence: IDA
            GeneID:1234 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
            GeneID:1234 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
            GeneID:1234 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IDA
            GeneID:1234 -> Cellular component: GO:0009986 [cell surface] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.