Home |
Help |
Advanced search
2024-04-16 17:07:27, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001099780 1894 bp mRNA linear PRI 18-MAR-2013
DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, beta type, 11
(PSMB11), mRNA.
ACCESSION NM_001099780 XM_063287 XM_940039
VERSION NM_001099780.1 GI:153791215
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1894)
AUTHORS Franke,N.E., Niewerth,D., Assaraf,Y.G., van Meerloo,J.,
Vojtekova,K., van Zantwijk,C.H., Zweegman,S., Chan,E.T., Kirk,C.J.,
Geerke,D.P., Schimmer,A.D., Kaspers,G.J., Jansen,G. and Cloos,J.
TITLE Impaired bortezomib binding to mutant beta5 subunit of the
proteasome is the underlying basis for bortezomib resistance in
leukemia cells
JOURNAL Leukemia 26 (4), 757-768 (2012)
PUBMED 21941364
REMARK GeneRIF: provide the first evidence that the mechanism underlying
BTZ resistance in these tumor cells is impaired binding of BTZ to
the mutant beta5 subunit of the proteasome
REFERENCE 2 (bases 1 to 1894)
AUTHORS Yamada,Y., Tomaru,U., Ishizu,A., Kiuchi,T., Marukawa,K., Matsuno,Y.
and Kasahara,M.
TITLE Expression of proteasome subunit beta5t in thymic epithelial tumors
JOURNAL Am. J. Surg. Pathol. 35 (9), 1296-1304 (2011)
PUBMED 21836487
REMARK GeneRIF: Proteasome beta5t is expressed in most type B and in some
type AB thymomas and is a marker useful in differentiating type B3
thymomas from thymic carcinomas when used in combination with other
diagnostic markers.
REFERENCE 3 (bases 1 to 1894)
AUTHORS Tomaru,U., Ishizu,A., Murata,S., Miyatake,Y., Suzuki,S.,
Takahashi,S., Kazamaki,T., Ohara,J., Baba,T., Iwasaki,S., Fugo,K.,
Otsuka,N., Tanaka,K. and Kasahara,M.
TITLE Exclusive expression of proteasome subunit {beta}5t in the human
thymic cortex
JOURNAL Blood 113 (21), 5186-5191 (2009)
PUBMED 19289856
REMARK GeneRIF: Human beta5t was expressed in approximately 80% of
cortical thymic epithelial cells and some cortical dendritic cells
REFERENCE 4 (bases 1 to 1894)
AUTHORS Murata,S., Sasaki,K., Kishimoto,T., Niwa,S., Hayashi,H.,
Takahama,Y. and Tanaka,K.
TITLE Regulation of CD8+ T cell development by thymus-specific
proteasomes
JOURNAL Science 316 (5829), 1349-1353 (2007)
PUBMED 17540904
REMARK GeneRIF: results suggest a key role for beta5t in generating the
MHC class I-restricted CD8(+) T cell repertoire during thymic
selection
REFERENCE 5 (bases 1 to 1894)
AUTHORS Margottin-Goguet,F., Hsu,J.Y., Loktev,A., Hsieh,H.M., Reimann,J.D.
and Jackson,P.K.
TITLE Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin
ligase activates the anaphase promoting complex to allow
progression beyond prometaphase
JOURNAL Dev. Cell 4 (6), 813-826 (2003)
PUBMED 12791267
REFERENCE 6 (bases 1 to 1894)
AUTHORS Geley,S., Kramer,E., Gieffers,C., Gannon,J., Peters,J.M. and
Hunt,T.
TITLE Anaphase-promoting complex/cyclosome-dependent proteolysis of human
cyclin A starts at the beginning of mitosis and is not subject to
the spindle assembly checkpoint
JOURNAL J. Cell Biol. 153 (1), 137-148 (2001)
PUBMED 11285280
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AK122797.1, AB299437.1 and AL132780.5.
On or before Jul 26, 2007 this sequence version replaced
gi:113424539, gi:113424831.
Summary: Proteasomes generate peptides that are presented by major
histocompatibility complex (MHC) I molecules to other cells of the
immune system. Proteolysis is conducted by 20S proteasomes,
complexes of 28 subunits arranged as a cylinder in 4
heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7,
and alpha-1 to -7. The catalytic subunits are beta-1 (PSMB6; MIM
600307), beta-2 (PSMB7; MIM 604030), and beta-5 (PSMB5; MIM
600306). Three additional subunits, beta-1i (PSMB9; MIM 177045),
beta-2i (PSMB10; MIM 176847), and beta-5i (PSMB8; MIM 177046), are
induced by gamma-interferon (IFNG; MIM 147570) and are
preferentially incorporated into proteasomes to make
immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit
expressed exclusively in cortical thymic epithelial cells (Murata
et al., 2007 [PubMed 17540904]).[supplied by OMIM, Mar 2008].
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-59 AK122797.1 1-59
60-962 AB299437.1 1-903
963-1894 AL132780.5 146926-147857
FEATURES Location/Qualifiers
source 1..1894
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="14"
/map="14q11.2"
gene 1..1894
/gene="PSMB11"
/gene_synonym="BETA5T"
/note="proteasome (prosome, macropain) subunit, beta type,
11"
/db_xref="GeneID:122706"
/db_xref="HGNC:31963"
/db_xref="MIM:611137"
exon 1..1894
/gene="PSMB11"
/gene_synonym="BETA5T"
/inference="alignment:Splign:1.39.8"
variation 27
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:112712793"
CDS 60..962
/gene="PSMB11"
/gene_synonym="BETA5T"
/EC_number="3.4.25.1"
/note="proteasome subunit beta 5T; proteasome subunit beta
type-11; proteasome subunit beta-5t"
/codon_start=1
/product="proteasome subunit beta type-11 precursor"
/protein_id="NP_001093250.1"
/db_xref="GI:153791216"
/db_xref="CCDS:CCDS41923.1"
/db_xref="GeneID:122706"
/db_xref="HGNC:31963"
/db_xref="MIM:611137"
/translation="
MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV
"
mat_peptide 207..959
/gene="PSMB11"
/gene_synonym="BETA5T"
/product="Proteasome subunit beta type-11"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (A5LHX3.1)"
misc_feature 207..770
/gene="PSMB11"
/gene_synonym="BETA5T"
/note="proteasome beta type-5 subunit. The 20S proteasome,
multisubunit proteolytic complex, is the central enzyme of
nonlysosomal protein degradation in both the cytosol and
nucleus. It is composed of 28 subunits arranged as four
homoheptameric rings that...; Region:
proteasome_beta_type_5; cd03761"
/db_xref="CDD:48459"
misc_feature order(207..209,255..257,261..263,303..305,594..596,
705..707,714..719)
/gene="PSMB11"
/gene_synonym="BETA5T"
/note="active site"
/db_xref="CDD:48459"
misc_feature order(261..263,270..272,276..293,351..353,357..359,
402..404,438..440,447..452,456..461,468..470,477..479,
549..551,555..557,561..572,579..581,603..608,612..617,
624..632,678..680,699..710,717..722)
/gene="PSMB11"
/gene_synonym="BETA5T"
/note="beta subunit interaction site [polypeptide
binding]; other site"
/db_xref="CDD:48459"
variation 69
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:368573284"
variation 72
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:371568107"
variation 112
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:376266336"
variation 127
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:201995713"
variation 151
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:372195981"
variation 163
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:143333062"
variation 184
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:199658278"
variation 187
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:377211873"
variation 196
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:369797442"
variation 204
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:34457782"
variation 210
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:376634369"
variation 215
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="g"
/replace="t"
/db_xref="dbSNP:200079214"
variation 225
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:201648089"
variation 226
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:200271665"
variation 232
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:201195202"
variation 248
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="g"
/replace="t"
/db_xref="dbSNP:201247533"
variation 260
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:201918029"
variation 262
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:375735265"
variation 287
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:371015502"
variation 305
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:375537695"
variation 318
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:368252220"
variation 319
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="t"
/db_xref="dbSNP:199826584"
variation 356
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:372598944"
variation 357
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:367634748"
variation 375
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:368096618"
variation 376
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:200308743"
variation 396
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:376450654"
variation 397
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:368800533"
variation 403
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:202220440"
variation 410
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:200575349"
variation 427
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:199598313"
variation 478
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:373716436"
variation 523
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:201138394"
variation 545
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:146768465"
variation 553
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:188881179"
variation 555
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:372908348"
variation 557
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:375580593"
variation 560
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:370430852"
variation 564
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:200339082"
variation 565
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:200639481"
variation 611
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:370750137"
variation 614
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:375515840"
variation 615
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:201834524"
variation 617
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:74813090"
variation 618
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:200046969"
variation 628
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:375292735"
variation 631
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:201925452"
variation 636
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:200829627"
variation 637
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:368938308"
variation 642
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:372279769"
variation 665
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:139406522"
variation 666
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:149885629"
variation 676
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:372718722"
variation 681
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:144901834"
variation 684
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:368929459"
variation 693
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:149026126"
variation 697
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:200922298"
variation 702
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:376216485"
variation 741
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:371415547"
variation 771
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:374473283"
variation 772
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:181637075"
variation 791
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="g"
/db_xref="dbSNP:199536850"
variation 794
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:186544245"
variation 820
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:200207927"
variation 822
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="g"
/db_xref="dbSNP:375269957"
variation 876
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="g"
/db_xref="dbSNP:368107811"
variation 883
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:201585987"
variation 896
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="g"
/db_xref="dbSNP:372255144"
variation 931
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:200979549"
variation 950
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="g"
/replace="t"
/db_xref="dbSNP:370165764"
variation 954
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:200708048"
variation 960
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:199803999"
variation 968
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:57362684"
variation 972
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:200420485"
variation 982
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:201541901"
variation 1035..1036
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace=""
/replace="c"
/db_xref="dbSNP:35767066"
variation 1035
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:143081149"
variation 1055
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:78162644"
variation 1091
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="g"
/replace="t"
/db_xref="dbSNP:72684308"
variation 1198
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="g"
/db_xref="dbSNP:147787314"
variation 1244
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:191357717"
variation 1309..1310
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace=""
/replace="c"
/db_xref="dbSNP:34446401"
variation 1376..1377
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace=""
/replace="t"
/db_xref="dbSNP:112156442"
variation 1379..1380
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace=""
/replace="g"
/replace="t"
/db_xref="dbSNP:111487083"
variation 1430
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:181411494"
variation 1463
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="t"
/db_xref="dbSNP:185831644"
variation 1534
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:191084894"
variation 1547
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:11628336"
variation 1566
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="c"
/db_xref="dbSNP:76262327"
variation 1597
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="t"
/db_xref="dbSNP:183311310"
variation 1604
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:146767387"
variation 1617
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="g"
/db_xref="dbSNP:28628049"
variation 1644
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="t"
/db_xref="dbSNP:188001191"
variation 1804
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="c"
/db_xref="dbSNP:139380940"
variation 1876
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:368906582"
variation 1877
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="a"
/replace="g"
/db_xref="dbSNP:190618518"
variation 1882
/gene="PSMB11"
/gene_synonym="BETA5T"
/replace="c"
/replace="t"
/db_xref="dbSNP:183176872"
ORIGIN
accagaccccagccacaaattcctggcttgcttcttccaaacttcattcagccccagggatggctctgcaggatgtgtgcaagtggcagtcccctgacacccagggaccatcacctcacctgcctcgggctggcggctgggctgtgccccggggttgtgaccctcaaaccttcctgcagatccatggccccagactggcccacggcaccaccactctggccttccgcttccgtcatggagtcattgctgcagctgacacgcgttcctcctgtggcagctatgtggcgtgtccagcctcatgcaaggtcatccctgtgcaccagcacctcctgggtaccacctctggcacctctgccgactgtgctacctggtatcgggtattacagcgggagctgcggcttcgggaactgagggagggtcagctgcccagtgtggccagtgctgccaagctcttgtcagccatgatgtctcaataccggggactggatctctgtgtggccactgccctctgcggctgggaccgctctggccctgagctcttctacgtctatagcgacggcacccgcctgcagggggacatcttctctgtgggctctggatctccctatgcctacggcgtgctagaccgtggctatcgctacgacatgagcacccaggaagcctacgccctggctcgctgcgccgtggcccacgccacccaccgtgatgcctattcagggggctctgtagaccttttccacgtgcgggagagtggatgggagcatgtgtcacgcagtgatgcctgtgtgctgtacgtggagttacagaagctcctggagccggagccagaggaggatgccagccatgcccatcctgagcctgccactgcccacagagctgcagaagatagagagctctctgtggggccaggggaggtgacaccaggagactccaggatgccagcagggactgagacggtgtgagaagcaggacttggttggggatggtgtaggcctggggagtgggtgggaggatgggcagcagggggagggtcccgctggcagcagcctcacagcgtctggctctagcctgtatgggttgctggcttcatttattgcaagtctccatcctttcatgactcccagagctattatggctctgcccaacaagttcctattgactcccagtggattggtccagcctccttcttggcaccaagtccgtctttcattcaacacttgcagtgtgcctactgcatgccagacgcatgctaggtgctagaccctcttttcttgccatcttctctgcttttttccatcatctcatccccagtttctcttagtttcggtcctttatgtgtctcagcttcagcgtctttgtctttttctcctgatcactttgtcagcatggtaagatggggcacccgggaagggagcagcccctctcagaacgaggcgtagtgatagacaccctttggatggtgatgggcttgtcttatctgctctccttctctgacttgaccatcatgactagaatgattatccctttactgaatgcagttctcatcgcaaccctttgaggtaaaaatgagtctctctttacagaagaggaatcaggttcaaagggttatgtggcttgccagggtcacacagtaagtggcagggatgacacttagatccaggccttctcctccagggtccatgctctttcagcacagctccccctcccaggccctctgccctgcctttcctctcttccctgcaggcttccggagagggatgtggagggagaaagtagctaggccagtcccctgcctggtggctcatgtggctttatcttccaggcctggagccatcccccacagcccacccttgctctccagctttctgggcctggcggtgccgctgccagactt
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:122706 -> Molecular function: GO:0004298 [threonine-type endopeptidase activity] evidence: IEA
GeneID:122706 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:122706 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:122706 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:122706 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:122706 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS
GeneID:122706 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:122706 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:122706 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:122706 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:122706 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:122706 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:122706 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:122706 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
GeneID:122706 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:122706 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:122706 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:122706 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:122706 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:122706 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:122706 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:122706 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:122706 -> Cellular component: GO:0005839 [proteasome core complex] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001093250 -> EC 3.4.25.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.