Home |
Help |
Advanced search
2024-04-27 09:08:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001098523 782 bp mRNA linear PRI 15-JUL-2013
DEFINITION Homo sapiens HIV-1 Tat interactive protein 2, 30kDa (HTATIP2),
transcript variant 5, mRNA.
ACCESSION NM_001098523
VERSION NM_001098523.1 GI:148728169
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 782)
AUTHORS Li,A., Zhang,C., Gao,S., Chen,F., Yang,C., Luo,R. and Xiao,H.
TITLE TIP30 loss enhances cytoplasmic and nuclear EGFR signaling and
promotes lung adenocarcinogenesis in mice
JOURNAL Oncogene 32 (18), 2273-2281 (2013)
PUBMED 22733137
REMARK GeneRIF: TIP30 acts as a crucial regulator in suppressing
cytoplasmic and nuclear EGFR signaling in the lung.TIP30 functions
as a tumor suppressor to inhibit EGFR cytoplasmic and nuclear
signaling and suppress adenocarcinogenesis in the lung.
REFERENCE 2 (bases 1 to 782)
AUTHORS Huang,Q.D., Hu,X.Q., Wan,L., Gao,G.H., Zheng,S.R., You,J. and
Guo,G.L.
TITLE [Clinical significance of CC3/TIP30 expression in breast carcinoma
and its correlation with HER-2/neu]
JOURNAL Zhonghua Wai Ke Za Zhi 50 (1), 57-61 (2012)
PUBMED 22490293
REMARK GeneRIF: The loss of CC3/TIP30 is related to occurrence and
development in breast cancer, suggesting early onset of metastasis
and recurrence.
REFERENCE 3 (bases 1 to 782)
AUTHORS Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
Gibbs,R.A. and Butte,N.F.
TITLE Novel genetic loci identified for the pathophysiology of childhood
obesity in the Hispanic population
JOURNAL PLoS ONE 7 (12), E51954 (2012)
PUBMED 23251661
REFERENCE 4 (bases 1 to 782)
AUTHORS Liu,D.C. and Yang,Z.L.
TITLE Clinicopathologic significance of minichromosome maintenance
protein 2 and Tat-interacting protein 30 expression in benign and
malignant lesions of the gallbladder
JOURNAL Hum. Pathol. 42 (11), 1676-1683 (2011)
PUBMED 21543106
REMARK GeneRIF: overexpression of MCM2 or loss of expression of
Tat-interacting protein 30 is closely related to carcinogenesis,
progression, biological behavior, and prognosis of gallbladder
adenocarcinoma.
REFERENCE 5 (bases 1 to 782)
AUTHORS Zhang,C., Li,A., Gao,S., Zhang,X. and Xiao,H.
TITLE The TIP30 protein complex, arachidonic acid and coenzyme A are
required for vesicle membrane fusion
JOURNAL PLoS ONE 6 (6), E21233 (2011)
PUBMED 21731680
REMARK GeneRIF: The TIP30 complex facilitates biological membrane fusion
through modification of phosphatidic acid on membranes.
REFERENCE 6 (bases 1 to 782)
AUTHORS Xiao,H., Palhan,V., Yang,Y. and Roeder,R.G.
TITLE TIP30 has an intrinsic kinase activity required for up-regulation
of a subset of apoptotic genes
JOURNAL EMBO J. 19 (5), 956-963 (2000)
PUBMED 10698937
REFERENCE 7 (bases 1 to 782)
AUTHORS Whitman,S., Wang,X., Shalaby,R. and Shtivelman,E.
TITLE Alternatively spliced products CC3 and TC3 have opposing effects on
apoptosis
JOURNAL Mol. Cell. Biol. 20 (2), 583-593 (2000)
PUBMED 10611237
REFERENCE 8 (bases 1 to 782)
AUTHORS Baker,M.E.
TITLE TIP30, a cofactor for HIV-1 Tat-activated transcription, is
homologous to short-chain dehydrogenases/reductases
JOURNAL Curr. Biol. 9 (13), R471 (1999)
PUBMED 10395547
REFERENCE 9 (bases 1 to 782)
AUTHORS Xiao,H., Tao,Y., Greenblatt,J. and Roeder,R.G.
TITLE A cofactor, TIP30, specifically enhances HIV-1 Tat-activated
transcription
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (5), 2146-2151 (1998)
PUBMED 9482853
REFERENCE 10 (bases 1 to 782)
AUTHORS Shtivelman,E.
TITLE A link between metastasis and resistance to apoptosis of variant
small cell lung carcinoma
JOURNAL Oncogene 14 (18), 2167-2173 (1997)
PUBMED 9174052
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AF092095.1 and AW963626.1.
Transcript Variant: This variant (5) differs in the 5' UTR, 3' UTR
and coding region, compared to variant 1. The resulting isoform (c,
also known as TC3) has a shorter N-terminus and a distinct
C-terminus, compared to isoform a.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF092095.1, BE504227.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-249 AF092095.1 2-250
250-740 AW963626.1 169-659
741-782 AF092095.1 743-784
FEATURES Location/Qualifiers
source 1..782
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11p15.1"
gene 1..782
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="HIV-1 Tat interactive protein 2, 30kDa"
/db_xref="GeneID:10553"
/db_xref="HGNC:16637"
/db_xref="MIM:605628"
exon 1..292
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/inference="alignment:Splign:1.39.8"
misc_feature 56..58
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="upstream in-frame stop codon"
variation 62
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:371982853"
variation 93
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:199846818"
CDS 98..499
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/EC_number="1.1.1.-"
/note="isoform c is encoded by transcript variant 5; short
chain dehydrogenase/reductase family 44U, member 1;
Tat-interacting protein (30kD); oxidoreductase HTATIP2;
HIV-1 TAT-interactive protein 2; 30 kDa HIV-1
TAT-interacting protein"
/codon_start=1
/product="oxidoreductase HTATIP2 isoform c"
/protein_id="NP_001091993.1"
/db_xref="GI:148728170"
/db_xref="CCDS:CCDS53613.1"
/db_xref="GeneID:10553"
/db_xref="HGNC:16637"
/db_xref="MIM:605628"
/translation="
MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAVRKAYALFPFCWPVISRILFLLTLFLCACCNA
"
misc_feature 152..>400
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
NADB_Rossmann; cl09931"
/db_xref="CDD:213117"
misc_feature 164..>409
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="NADH(P)-binding; Region: NAD_binding_10; pfam13460"
/db_xref="CDD:205638"
misc_feature order(170..172,176..181,185..187,248..256,368..376)
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="NAD(P) binding site [chemical binding]; other site"
/db_xref="CDD:187535"
variation 102
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:369625277"
variation 187
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:191533610"
variation 206
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:202128953"
variation 222
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:200846453"
variation 241
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:145143466"
variation 245
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:200473579"
variation 256
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="g"
/db_xref="dbSNP:145549108"
exon 293..774
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/inference="alignment:Splign:1.39.8"
variation 331
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:112368564"
variation 339
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:144136689"
variation 350
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:146530848"
variation 355
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:77126933"
variation 356
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:14273"
variation 362
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:140788394"
variation 371
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:377269888"
variation 393
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="g"
/db_xref="dbSNP:143928186"
variation 394
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:200863409"
variation 399
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:148194087"
variation 418
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="t"
/db_xref="dbSNP:368702125"
variation 439
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="c"
/db_xref="dbSNP:180783675"
variation 450
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:199547698"
variation 551
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:376742608"
variation 613
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:79428826"
variation 623
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:186221694"
variation 626
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:140571420"
variation 751
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:114226297"
polyA_signal 753..758
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
polyA_site 774
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
ORIGIN
tcctccctaacagataaacagcccttgttcctcgggataaggactggcagtcccctgacaccctaagaccggcatctgtcgatgttatttccccagcatggccgaaacagaagccctgtcgaagcttcgggaagacttcaggatgcagaataaatccgtctttattttgggcgccagcggagaaaccggcagagtgctcttaaaggaaatcctggagcagggcctgttttccaaagtcacgctcattggccggaggaagctcaccttcgacgaggaagcttataaaaatgtgaatcaagaagtggtggactttgaaaagttggatgactacgcctctgcctttcaaggtcatgatgttggattctgttgcctgggtaccaccagagggaaagctggggcggtaaggaaggcatatgctcttttccctttttgctggccagtaatatcaaggattcttttcttgctcactctttttctttgtgcctgttgcaatgcttaaatgtgaataagcctttattgtttaagattctatatgctgcactaacctttggtatccttttaatagtactgataagttcgtctttcaaagtaatccttgagttcaggccccagtgctggagacgtcgtaaatatttacatgattttgcctattgtgattatcgctatcactacatcccctgactaagggaaaccatgatgtctgagtaaaactaattggtttatgctgttaacaatcagctgtttttccccttaataaatgtttgaaatttgaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10553 -> Molecular function: GO:0003713 [transcription coactivator activity] evidence: TAS
GeneID:10553 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10553 -> Molecular function: GO:0016491 [oxidoreductase activity] evidence: IEA
GeneID:10553 -> Biological process: GO:0001525 [angiogenesis] evidence: IEA
GeneID:10553 -> Biological process: GO:0006357 [regulation of transcription from RNA polymerase II promoter] evidence: TAS
GeneID:10553 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:10553 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:10553 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA
GeneID:10553 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:10553 -> Biological process: GO:0045765 [regulation of angiogenesis] evidence: IDA
GeneID:10553 -> Biological process: GO:0051170 [nuclear import] evidence: IDA
GeneID:10553 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
GeneID:10553 -> Cellular component: GO:0005635 [nuclear envelope] evidence: IDA
GeneID:10553 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001091993 -> EC 1.1.1.-
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.