Home |
Help |
Advanced search
2024-04-26 09:28:37, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001098521 1437 bp mRNA linear PRI 15-JUL-2013
DEFINITION Homo sapiens HIV-1 Tat interactive protein 2, 30kDa (HTATIP2),
transcript variant 3, mRNA.
ACCESSION NM_001098521
VERSION NM_001098521.1 GI:148728167
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1437)
AUTHORS Li,A., Zhang,C., Gao,S., Chen,F., Yang,C., Luo,R. and Xiao,H.
TITLE TIP30 loss enhances cytoplasmic and nuclear EGFR signaling and
promotes lung adenocarcinogenesis in mice
JOURNAL Oncogene 32 (18), 2273-2281 (2013)
PUBMED 22733137
REMARK GeneRIF: TIP30 acts as a crucial regulator in suppressing
cytoplasmic and nuclear EGFR signaling in the lung.TIP30 functions
as a tumor suppressor to inhibit EGFR cytoplasmic and nuclear
signaling and suppress adenocarcinogenesis in the lung.
REFERENCE 2 (bases 1 to 1437)
AUTHORS Huang,Q.D., Hu,X.Q., Wan,L., Gao,G.H., Zheng,S.R., You,J. and
Guo,G.L.
TITLE [Clinical significance of CC3/TIP30 expression in breast carcinoma
and its correlation with HER-2/neu]
JOURNAL Zhonghua Wai Ke Za Zhi 50 (1), 57-61 (2012)
PUBMED 22490293
REMARK GeneRIF: The loss of CC3/TIP30 is related to occurrence and
development in breast cancer, suggesting early onset of metastasis
and recurrence.
REFERENCE 3 (bases 1 to 1437)
AUTHORS Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
Gibbs,R.A. and Butte,N.F.
TITLE Novel genetic loci identified for the pathophysiology of childhood
obesity in the Hispanic population
JOURNAL PLoS ONE 7 (12), E51954 (2012)
PUBMED 23251661
REFERENCE 4 (bases 1 to 1437)
AUTHORS Liu,D.C. and Yang,Z.L.
TITLE Clinicopathologic significance of minichromosome maintenance
protein 2 and Tat-interacting protein 30 expression in benign and
malignant lesions of the gallbladder
JOURNAL Hum. Pathol. 42 (11), 1676-1683 (2011)
PUBMED 21543106
REMARK GeneRIF: overexpression of MCM2 or loss of expression of
Tat-interacting protein 30 is closely related to carcinogenesis,
progression, biological behavior, and prognosis of gallbladder
adenocarcinoma.
REFERENCE 5 (bases 1 to 1437)
AUTHORS Zhang,C., Li,A., Gao,S., Zhang,X. and Xiao,H.
TITLE The TIP30 protein complex, arachidonic acid and coenzyme A are
required for vesicle membrane fusion
JOURNAL PLoS ONE 6 (6), E21233 (2011)
PUBMED 21731680
REMARK GeneRIF: The TIP30 complex facilitates biological membrane fusion
through modification of phosphatidic acid on membranes.
REFERENCE 6 (bases 1 to 1437)
AUTHORS Xiao,H., Palhan,V., Yang,Y. and Roeder,R.G.
TITLE TIP30 has an intrinsic kinase activity required for up-regulation
of a subset of apoptotic genes
JOURNAL EMBO J. 19 (5), 956-963 (2000)
PUBMED 10698937
REFERENCE 7 (bases 1 to 1437)
AUTHORS Whitman,S., Wang,X., Shalaby,R. and Shtivelman,E.
TITLE Alternatively spliced products CC3 and TC3 have opposing effects on
apoptosis
JOURNAL Mol. Cell. Biol. 20 (2), 583-593 (2000)
PUBMED 10611237
REFERENCE 8 (bases 1 to 1437)
AUTHORS Baker,M.E.
TITLE TIP30, a cofactor for HIV-1 Tat-activated transcription, is
homologous to short-chain dehydrogenases/reductases
JOURNAL Curr. Biol. 9 (13), R471 (1999)
PUBMED 10395547
REFERENCE 9 (bases 1 to 1437)
AUTHORS Xiao,H., Tao,Y., Greenblatt,J. and Roeder,R.G.
TITLE A cofactor, TIP30, specifically enhances HIV-1 Tat-activated
transcription
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (5), 2146-2151 (1998)
PUBMED 9482853
REFERENCE 10 (bases 1 to 1437)
AUTHORS Shtivelman,E.
TITLE A link between metastasis and resistance to apoptosis of variant
small cell lung carcinoma
JOURNAL Oncogene 14 (18), 2167-2173 (1997)
PUBMED 9174052
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DB450790.1, AC025972.6, AK222969.1 and BC015358.2.
Transcript Variant: This variant (3) uses an alternate 5' exon and
differs in the 5' UTR, compared to variant 1. These differences
cause translation initiation at a downstream AUG and an isoform (b,
also known as CC3) with a shorter N-terminus compared to isoform a.
Variants 2, 3 and 4 encode the same isoform.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK292092.1, BG532825.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-2 DB450790.1 1-2
3-82 AC025972.6 135249-135328
83-109 DB450790.1 82-108
110-1402 AK222969.1 66-1358
1403-1437 BC015358.2 1381-1415
FEATURES Location/Qualifiers
source 1..1437
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11p15.1"
gene 1..1437
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="HIV-1 Tat interactive protein 2, 30kDa"
/db_xref="GeneID:10553"
/db_xref="HGNC:16637"
/db_xref="MIM:605628"
exon 1..98
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/inference="alignment:Splign:1.39.8"
variation 75..76
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace=""
/replace="c"
/db_xref="dbSNP:375714821"
variation 77
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="c"
/db_xref="dbSNP:182333117"
exon 99..294
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/inference="alignment:Splign:1.39.8"
CDS 100..828
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/EC_number="1.1.1.-"
/note="isoform b is encoded by transcript variant 3; short
chain dehydrogenase/reductase family 44U, member 1;
Tat-interacting protein (30kD); oxidoreductase HTATIP2;
HIV-1 TAT-interactive protein 2; 30 kDa HIV-1
TAT-interacting protein"
/codon_start=1
/product="oxidoreductase HTATIP2 isoform b"
/protein_id="NP_001091991.1"
/db_xref="GI:148728168"
/db_xref="CCDS:CCDS7852.1"
/db_xref="GeneID:10553"
/db_xref="HGNC:16637"
/db_xref="MIM:605628"
/translation="
MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
"
misc_feature 154..792
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="CC3(TIP30)-like, atypical (a) SDRs; Region:
CC3_like_SDR_a; cd05250"
/db_xref="CDD:187560"
misc_feature 166..>609
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="NADH(P)-binding; Region: NAD_binding_10; pfam13460"
/db_xref="CDD:205638"
misc_feature order(172..174,178..189,253..258,313..315,370..381,
418..420,430..432,487..495,526..528,538..540,598..609)
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="NAD binding site [chemical binding]; other site"
/db_xref="CDD:187560"
misc_feature order(421..423,493..495,526..528,538..540)
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/note="active site"
/db_xref="CDD:187560"
variation 104
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:369625277"
variation 189
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:191533610"
variation 208
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:202128953"
variation 224
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:200846453"
variation 243
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:145143466"
variation 247
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:200473579"
variation 258
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="g"
/db_xref="dbSNP:145549108"
exon 295..402
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/inference="alignment:Splign:1.39.8"
variation 333
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:112368564"
variation 341
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:144136689"
variation 352
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:146530848"
variation 357
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:77126933"
variation 358
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:14273"
variation 364
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:140788394"
variation 373
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:377269888"
variation 395
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="g"
/db_xref="dbSNP:143928186"
variation 396
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:200863409"
variation 401
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:148194087"
exon 403..540
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/inference="alignment:Splign:1.39.8"
variation 431
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:140080675"
variation 435
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:140165037"
variation 460
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="g"
/db_xref="dbSNP:181081777"
variation 481
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:377524639"
variation 489
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:150327548"
variation 503
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="c"
/db_xref="dbSNP:370929399"
variation 510
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:141995111"
exon 541..602
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/inference="alignment:Splign:1.39.8"
variation 556
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:138879906"
variation 580
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:376468659"
variation 583
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:370076424"
exon 603..1406
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/inference="alignment:Splign:1.39.8"
variation 606
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:143261552"
variation 658
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:1051776"
variation 679..680
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace=""
/replace="c"
/db_xref="dbSNP:35285540"
variation 690
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:3824886"
variation 695
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="c"
/db_xref="dbSNP:79296772"
variation 702
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:142077207"
variation 715
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:144100738"
variation 720
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:373986235"
variation 780
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="g"
/db_xref="dbSNP:187804828"
variation 784
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="g"
/db_xref="dbSNP:14222"
variation 792
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:200003351"
variation 807
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:202065100"
variation 826
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace=""
/replace="t"
/db_xref="dbSNP:370774686"
variation 834
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:3781679"
variation 964
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:372324685"
variation 1017
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:191247504"
variation 1100
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="c"
/db_xref="dbSNP:183794581"
variation 1138
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:375554086"
variation 1212
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:16906210"
variation 1245
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="a"
/replace="g"
/db_xref="dbSNP:369175509"
STS 1247..1386
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/standard_name="G29234"
/db_xref="UniSTS:63559"
variation 1291
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="g"
/replace="t"
/db_xref="dbSNP:188466553"
variation 1331
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
/replace="c"
/replace="t"
/db_xref="dbSNP:77228546"
polyA_signal 1375..1380
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
polyA_signal 1383..1388
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
polyA_site 1406
/gene="HTATIP2"
/gene_synonym="CC3; SDR44U1; TIP30"
ORIGIN
ggcggggcgaggcagcgtcgccgcgaggccacccggaagaccaagccgggtaggcgctgtctccgtcgcctccaacccccccggtccgaccagggaagcatggccgaaacagaagccctgtcgaagcttcgggaagacttcaggatgcagaataaatccgtctttattttgggcgccagcggagaaaccggcagagtgctcttaaaggaaatcctggagcagggcctgttttccaaagtcacgctcattggccggaggaagctcaccttcgacgaggaagcttataaaaatgtgaatcaagaagtggtggactttgaaaagttggatgactacgcctctgcctttcaaggtcatgatgttggattctgttgcctgggtaccaccagagggaaagctggggcggagggatttgttcgtgttgaccgagattatgtgctgaagtctgcagagctggcaaaagctggagggtgcaaacatttcaacttgctatcctctaaaggagctgataaatcaagcaattttttatatctacaagttaagggagaagtagaagccaaggttgaagaattaaaatttgatcgttactctgtatttaggcctggagttctgttatgtgataggcaagaatctcgcccaggtgaatggctggttagaaagttctttggctccttaccagactcttgggccagtgggcattctgtgcctgtggtgaccgtggttagagcaatgctgaacaatgtggtgagaccaagagacaagcagatggaactgctggagaacaaggccatccatgacctggggaaagcgcatggctctctcaagccatgaccacattggagaaatggtttttattgtcaaccttaacacccatcaccaaatcggtaatttcagggtctaaaaaaagtcagcatgttttaactttgttgttttactatcctcaggcatccattccaatcaagaaatgatggtgctctgcatcagtggttcagagcctggttatacatatagatcactcagggagctttggaaaaataaagatttgtcagccctatctcaaacttgaatcaaaatttctggggtgtgggcacaataatctgtaattttctttgtttatacttcccctgatgccactggttccgatgccactggctggggggcctgctttgaaatgcttgtctgcagagtcacagcagccatgaaaaccttatgaccgtgcaaatgagctctgctctaaaattgttgacattcatgtctctgagttacaaaagtgctaattcactacatgtaattgtgtaagtaaacattgtgcctttactacttctttatgtaatagaagttatatacctaagcttatataatacatggggaggattaaataaaggaataaagatgaatggacaactcctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10553 -> Molecular function: GO:0003713 [transcription coactivator activity] evidence: TAS
GeneID:10553 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10553 -> Molecular function: GO:0016491 [oxidoreductase activity] evidence: IEA
GeneID:10553 -> Biological process: GO:0001525 [angiogenesis] evidence: IEA
GeneID:10553 -> Biological process: GO:0006357 [regulation of transcription from RNA polymerase II promoter] evidence: TAS
GeneID:10553 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:10553 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:10553 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA
GeneID:10553 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:10553 -> Biological process: GO:0045765 [regulation of angiogenesis] evidence: IDA
GeneID:10553 -> Biological process: GO:0051170 [nuclear import] evidence: IDA
GeneID:10553 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
GeneID:10553 -> Cellular component: GO:0005635 [nuclear envelope] evidence: IDA
GeneID:10553 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001091991 -> EC 1.1.1.-
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.