GGRNA Home | Help | Advanced search

2020-10-30 18:41:17, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001079537            3364 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens trafficking protein particle complex 6B (TRAPPC6B),
            transcript variant 1, mRNA.
ACCESSION   NM_001079537
VERSION     NM_001079537.1  GI:118600990
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3364)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
REFERENCE   2  (bases 1 to 3364)
  AUTHORS   Gwynn,B., Smith,R.S., Rowe,L.B., Taylor,B.A. and Peters,L.L.
  TITLE     A mouse TRAPP-related protein is involved in pigmentation
  JOURNAL   Genomics 88 (2), 196-203 (2006)
   PUBMED   16697553
REFERENCE   3  (bases 1 to 3364)
  AUTHORS   Kummel,D., Muller,J.J., Roske,Y., Misselwitz,R., Bussow,K. and
            Heinemann,U.
  TITLE     The structure of the TRAPP subunit TPC6 suggests a model for a
            TRAPP subcomplex
  JOURNAL   EMBO Rep. 6 (8), 787-793 (2005)
   PUBMED   16025134
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL132639.4, BX161510.1 and AK025437.1.
            
            Summary: TRAPPC6B is a component of TRAPP complexes, which are
            tethering complexes involved in vesicle transport (Kummel et al.,
            2005 [PubMed 16025134]).[supplied by OMIM, Mar 2008].
            
            Transcript Variant: This variant (1) represents the longer
            transcript and encodes the longer isoform (1).
            
            CCDS Note: This CCDS ID represents the longer isoform encoded by
            the TRAPPC6B gene. The shorter isoform is represented by
            CCDS9670.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AL833179.1, BX161510.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025098 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-108               AL132639.4         13153-13260         c
            109-3318            BX161510.1         1-3210
            3319-3364           AK025437.1         1977-2022
FEATURES             Location/Qualifiers
     source          1..3364
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q21.1"
     gene            1..3364
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /note="trafficking protein particle complex 6B"
                     /db_xref="GeneID:122553"
                     /db_xref="HGNC:23066"
                     /db_xref="MIM:610397"
     exon            1..416
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /inference="alignment:Splign:1.39.8"
     variation       105
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:175341"
     misc_feature    327..329
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /note="upstream in-frame stop codon"
     CDS             336..812
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /note="isoform 1 is encoded by transcript variant 1;
                     trafficking protein particle complex subunit 6B"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 6B
                     isoform 1"
                     /protein_id="NP_001073005.1"
                     /db_xref="GI:118600991"
                     /db_xref="CCDS:CCDS41947.1"
                     /db_xref="GeneID:122553"
                     /db_xref="HGNC:23066"
                     /db_xref="MIM:610397"
                     /translation="
MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL
"
     misc_feature    351..809
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /note="Transport protein particle (TRAPP) component;
                     Region: TRAPP; pfam04051"
                     /db_xref="CDD:217862"
     exon            417..484
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /inference="alignment:Splign:1.39.8"
     variation       453
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:435727"
     variation       454
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:435728"
     exon            485..602
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /inference="alignment:Splign:1.39.8"
     exon            603..686
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /inference="alignment:Splign:1.39.8"
     exon            687..780
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /inference="alignment:Splign:1.39.8"
     exon            781..3351
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /inference="alignment:Splign:1.39.8"
     STS             1039..1193
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /standard_name="SGC44285"
                     /db_xref="UniSTS:63893"
     STS             1040..1139
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /standard_name="SHGC-44285"
                     /db_xref="UniSTS:28250"
     variation       1680
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:926971"
     STS             1987..2098
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /standard_name="RH44741"
                     /db_xref="UniSTS:60192"
     variation       2102
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1128054"
     STS             3111..3294
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /standard_name="RH11234"
                     /db_xref="UniSTS:24662"
     STS             3184..3303
                     /gene="TRAPPC6B"
                     /gene_synonym="TPC6"
                     /standard_name="WI-15625"
                     /db_xref="UniSTS:59713"
ORIGIN      
gaatgccggggtagaggggaccggaagttgtttttttcgcccccgcccagcggccggatcgcatctcagctggttggctttggttagagctcccgtcagactttagttcggccctaggatttggtagccccgaagtgtgggctctctccagtaccagactcatttcagtaccagcctttgggaagtcgtgtgaatacctcggtctcttagccacagggatagaatggcggcctgacggagccgcggcgccggcgaagtcgctgaggcgcgagctggaacccccagaccagctcaaacgggagccaaaactcgaagcttggaagaattagcaggaaatggcggatgaggcgttgtttttgcttctccataacgagatggtgtctggagtgtacaagtccgcggagcagggggaggtggaaaacggacgatgtattactaagctggaaaacatggggtttcgagtgggacaaggattgatagaaaggtttacaaaagatactgcaaggttcaaggatgagttagatatcatgaagttcatttgtaaagatttttggactacggtattcaagaaacaaatcgacaatctaaggacaaatcatcagggcatctatgtacttcaggacaacaaatttcgcctgcttactcagatgtctgcaggaaaacagtatttagaacatgcatctaagtatttagcatttacgtgtggcttaatcagaggtggcttatcaaacttgggaataaaaagtattgtaacagctgaagtgtcttcaatgcctgcttgcaaatttcaggtgatgatacagaagctgtagaacatactgaaatgcaaggcttcaacagtgtaaagagataaattattcatgtaaaagtatttcaagtagtgatgatttaattacattgttcgatgtttgtacaggagtaagcatgtatttttatcaatttaacacagatcaaaggagatgaagggacattctgccatgacatacacttaaccaaaactattcaaaatgaaaaccggatttcaaataaccagacaccaagatgcagggcccttattttaaacctttttatttggttagagtgatatgtatttagccatagatggagaaacaaagctcagggtttgttgaattagcatgagagaaaattatgtaccaacagaattatttgtgagaagaatgaacaaattttgataaagtatgaatttgttttattttaaaaagcaaacatactaaattttttttattttattgcttataatttattaagaatgtttacacctgtataaggatttcatatatacattgtatgtgtgtatatataaatacatatatgactgcctaaattgtttataaatttaatttttctttaataggtttcattccttcagagctccattaatgtaatcaaaatgaaatatagattagtttaaatgtgaattcagtgactctagggccaaagaatattaggtatgtttggaaagaatttttgtatttattcctgttacagttttgactttcaacttctctccccgtgcatggaagtcctggtaaaggatctaacatctttattcccttctttcctcttccagctgagcagagttggataattgaattagtcattctgacattctttggaccatatcatcttagtggtttggggtcagtgctcatctgatatatctttcttaccacctcttctacttactttctcttacttaaattatctggcataagcagttatctccagcttttgttagaatcttgcatgttgattactaaaactatactttgtttcccatttatttattacccttttgcatgtatttgtgtgacagggaactctgcagcagggggtgactgacacaccaaacaagatgtttcactgggtactctgccatagaaatggcagattaagaagattgactataccaaacattatattaaaaacacaaaataaaaactataaaaatgtactttaggacattaaagaaaactcaagttagaagcataccattttcctttcatggaagggtacagtattacaaagataatttgtttaacttgatttattaaattctagttatgtgccctataatgatgtttcagtcagtgacagacctcatatatggcagtggttccataagattacaatactgtatttttactgtaccttctttatgtttagatatgcaagtacttaccattgtgttacagtgtcctacagtattcactacaataatatgctgtacaggtttgtagcctaggagcaataggccatagcttaggtgtatagtagatcataccatctaggtttgtgtaagtacactctgtgattgtacaattttaaaatctcctaatgatgatgcatttctcagaatgtatcccctttgctaagcaatgcatgactgcaatcctaattctcacatgttttggggaaaaaattttaattttgaaaaaatttaggaaagttcctaccaaatatacatgtataaagtttattaaaagtcataatgacccaggaatagctaatgacacagaagtagatcaaaatagaacacaatagagaacttcaaaataaaacaggtgtgagaattgtgtgtgtgaaaaagctgggttcaaataagttggtttgttagacattcatatgcctacccatcagccatttcgttctcccttccttgctgacaaagccccattttttttttctttttttttggcctaaaactctgtatggctgccttgtgctatagaatagggtgcttccctagcctagagagggtgagtgttgattagattctgtgccaatcatggtaattggcttacttgatcatttgatggaatctaggctaacgagacaaaggaagtctgaaggctttgaataagaaattttctgttgctcttaacaattgatacaagttagggatttgccagcatccctcttctgcttctcagtgaagatatgtgatatggatgtttgaagctaatctgcaacagccttctgatggccatgaaaggacaagtatggagatgaaagctatcacactgagaatagtgggatgtagatagaaagcacctgaattgtgcttctgaattaaccaatccaggaactgctttacctttggactttttgttatgtgagatattctttatattgttccatttgctttgggtatatgtatattgttacttgtagccaaaaagaaacctctcttagtagaaacaaagggagagttaggttattcaaaaattagtatgggacaattgaatatgcctttttctgcgggagtaggtggggagaaacttaaaggttcacttgtaaaacaataaagtactaaagaaaatgtgataaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:122553 -> Biological process: GO:0016192 [vesicle-mediated transport] evidence: IEA
            GeneID:122553 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IEA
            GeneID:122553 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.