GGRNA Home | Help | Advanced search

2020-10-26 19:43:33, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001077242            1774 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens DEP domain containing 7 (DEPDC7), transcript variant
            1, mRNA.
ACCESSION   NM_001077242
VERSION     NM_001077242.1  GI:116256341
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1774)
  AUTHORS   Gawin,B., Niederfuhr,A., Schumacher,N., Hummerich,H., Little,P.F.
            and Gessler,M.
  TITLE     A 7.5 Mb sequence-ready PAC contig and gene expression map of human
            chromosome 11p13-p14.1
  JOURNAL   Genome Res. 9 (11), 1074-1086 (1999)
   PUBMED   10568747
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC030970.1 and AJ245600.1.
            
            Transcript Variant: This variant (1) represents the more frequently
            occurring transcript and it encodes the longer protein (isoform 1).
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC030970.1, BC011446.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-45                BC030970.1         1-45
            46-874              AJ245600.1         1-829
            875-1434            BC030970.1         875-1434
            1435-1774           AJ245600.1         1390-1729
FEATURES             Location/Qualifiers
     source          1..1774
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11p13"
     gene            1..1774
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="DEP domain containing 7"
                     /db_xref="GeneID:91614"
                     /db_xref="HGNC:29899"
                     /db_xref="MIM:612294"
     exon            1..165
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       27
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138524582"
     variation       49
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375775065"
     variation       57
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144143644"
     variation       82
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376201426"
     variation       92
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115832789"
     CDS             93..1628
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="isoform 1 is encoded by transcript variant 1; DEP
                     domain-containing protein 7; novel 58.3 KDA protein;
                     dJ85M6.4 (novel 58.3 KDA protein)"
                     /codon_start=1
                     /product="DEP domain-containing protein 7 isoform 1"
                     /protein_id="NP_001070710.1"
                     /db_xref="GI:116256342"
                     /db_xref="CCDS:CCDS41632.1"
                     /db_xref="GeneID:91614"
                     /db_xref="HGNC:29899"
                     /db_xref="MIM:612294"
                     /translation="
MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSEAVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNTEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD
"
     misc_feature    207..491
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="DEP (Dishevelled, Egl-10, and Pleckstrin) domain
                     found in DEPDC4-like proteins. DEPDC4 is a DEP domain
                     containing protein of unknown function; Region:
                     DEP_DEPDC4; cd04446"
                     /db_xref="CDD:80329"
     misc_feature    546..548
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q96QD5.1); phosphorylation site"
     misc_feature    672..1373
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="RhoGAP_BRCC3-like: RhoGAP (GTPase-activator protein
                     [GAP] for Rho-like small GTPases) domain of BRCC3-like
                     proteins. This subgroup also contains two groups of
                     closely related proteins, BRCC3 and DEPDC7, which both
                     contain a C-terminal RhoGAP-like domain...; Region:
                     RhoGAP_BRCC3-like; cd04405"
                     /db_xref="CDD:63874"
     misc_feature    order(855..857,1011..1013,1023..1025,1233..1235,
                     1242..1247,1308..1310)
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="putative GTPase interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:63874"
     misc_feature    855..857
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:63874"
     exon            166..556
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       173
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375593314"
     variation       198
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368794067"
     variation       204
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79199473"
     variation       231
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200073795"
     variation       264
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374733737"
     variation       270
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369053359"
     variation       274
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200057806"
     variation       289
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138325318"
     variation       329
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:74559182"
     variation       380
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369355382"
     variation       394
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372513278"
     variation       463
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376814687"
     variation       472
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371496330"
     variation       482
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202173561"
     variation       543
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374632275"
     exon            557..684
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       584
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367903882"
     variation       624
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200200424"
     variation       638
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:17852860"
     variation       643
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200498367"
     variation       666
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34161108"
     exon            685..874
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       688
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144655252"
     variation       703
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:375290990"
     variation       721
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201784282"
     variation       725
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371231815"
     variation       782
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190343171"
     variation       792
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374772959"
     variation       804
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199885269"
     variation       805
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148509454"
     variation       843
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373000064"
     variation       855
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201199439"
     variation       870
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369472957"
     exon            875..1086
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       941
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:202124209"
     STS             952..1079
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /standard_name="AB070065"
                     /db_xref="UniSTS:480067"
     variation       956
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:36077875"
     variation       973
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370729400"
     variation       987
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75979055"
     variation       1025..1026
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35988670"
     variation       1032
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377186754"
     variation       1035
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370596448"
     variation       1058
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:966191"
     exon            1087..1229
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       1098
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:371828635"
     variation       1100
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:183771544"
     variation       1166
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375119204"
     variation       1188
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369520659"
     exon            1230..1355
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       1276
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374663038"
     exon            1356..1434
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     variation       1396
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373073447"
     variation       1402
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376408973"
     variation       1409
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370490867"
     variation       1424
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:185768707"
     exon            1435..1755
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /inference="alignment:Splign:1.39.8"
     STS             1446..1631
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /standard_name="RH99094"
                     /db_xref="UniSTS:83970"
     variation       1449
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148565354"
     variation       1453
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374445520"
     variation       1464
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202020074"
     variation       1477
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368852267"
     variation       1483
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17852859"
     variation       1504
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374403792"
     variation       1571
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367948856"
     variation       1580
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199502210"
     variation       1585
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142956576"
     variation       1595
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377079128"
     variation       1624
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201413831"
     variation       1643
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202246545"
     variation       1652
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151112215"
     variation       1667
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200612237"
     variation       1705
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1059432"
     variation       1712
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374578661"
     polyA_signal    1735..1740
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
     polyA_site      1755
                     /gene="DEPDC7"
                     /gene_synonym="dJ85M6.4; TR2"
ORIGIN      
gagccacgccccgcacagttaacagacgggcgctcagggagctagggagctgtgaagctgctggaggagttggcgtccggggagcaagggccatggccaccgtgcaggagaaggctgctgcgctgaacctctcggctctccacagccccgcgcacaggcctccgggtttcagtgtagctcagaagccatttggagccacgtatgtatggagcagcatcataaacactcttcaaacacaagtggaagtgaaaaaacgaaggcaccgtttaaaacgacataatgactgctttgttggttcagaagctgtggatgtcattttttctcacctaattcagaataagtattttggtgatgtagatattcctcgagccaaagtggtgagagtgtgtcaagcgcttatggactacaaagtatttgaagcagttccaaccaaagtctttggaaaagacaaaaaacctacatttgaagatagtagttgcagcctttatagattcaccacaatacctaaccaagacagtcagttaggcaaagagaacaaactatattcacctgccaggtatgcagatgcattatttaagtcatccgatatcagatcagccagtttagaggacctgtgggaaaatctgagtttaaagcctgccaactcccctcatgtaaatatctctgcaaccttgtctccacaagttattaatgaagtgtggcaagaagaaacaattgggcgtctactacaacttgtagaccttccacttcttgactccttactgaaacagcaagaggctgtacctaaaattcctcaacctaagaggcagtccaccatggtcaacagcagtaactatctggatcgagggattctcaaggcttatagtgactctcaggaagatgagtggctctcggcagcaattgactgtttagaataccttccagaccaaatggtggtggaaataagcagaagctttcctgagcaaccagaccgaacagacttagtgaaagaacttctgtttgatgccattggcagatattacagtagtagggaacctctgttaaatcacttatctgacgttcataatggaattgcagaactcttagtgaatgggaagacggaaatagctttagaagctacccagctccttctaaagcttttagatttccaaaatagagaagaatttagaagactactgtatttcatggctgttgcagcaaatccttctgagtttaaattacagaaagaaagtgacaaccgaatggttgtgaaaaggatattctcaaaagctattgttgacaataaaaatttatccaaaggcaaaacagatcttctggtactctttttaatggatcatcagaaagatgtttttaagattcctggaactctacataaaattgtaagtgttaagcttatggccatacagaacggaagagatccaaatagagatgcaggatatatttattgccagagaattgatcaacgtgactattccaacaatacagagaagacaaccaaagatgagctgttgaatttactaaaaactcttgatgaggattcaaaactttctgccaaagagaagaaaaaattgctaggtcaattctataagtgtcacccagacatctttattgagcattttggagactgagtttttaatatctgtatataagttgtgtattttaagaataaattatgtatcctaaatatccaatcacatttgtaagcgtggaagctctaaatttgaaactgtacttaataaaaatttttttgtataaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:91614 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
            GeneID:91614 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: TAS
            GeneID:91614 -> Biological process: GO:0008150 [biological_process] evidence: ND
            GeneID:91614 -> Biological process: GO:0051056 [regulation of small GTPase mediated signal transduction] evidence: TAS
            GeneID:91614 -> Cellular component: GO:0005575 [cellular_component] evidence: ND
            GeneID:91614 -> Cellular component: GO:0005829 [cytosol] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.