Home |
Help |
Advanced search
2024-04-20 00:19:09, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001042507 506 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens lectin, galactoside-binding, soluble, 7B (LGALS7B),
mRNA.
ACCESSION NM_001042507 XM_927748 XM_940513
VERSION NM_001042507.3 GI:194688137
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 506)
AUTHORS Saussez,S., Decaestecker,C., Lorfevre,F., Chevalier,D.,
Mortuaire,G., Kaltner,H., Andre,S., Toubeau,G., Gabius,H.J. and
Leroy,X.
TITLE Increased expression and altered intracellular distribution of
adhesion/growth-regulatory lectins galectins-1 and -7 during tumour
progression in hypopharyngeal and laryngeal squamous cell
carcinomas
JOURNAL Histopathology 52 (4), 483-493 (2008)
PUBMED 18315601
REMARK GeneRIF: An association was seen between the level of presence of
galectins-1 and -7 and neoplastic progression of hypopharyngeal and
laryngeal squamous cell carcinomas.
REFERENCE 2 (bases 1 to 506)
AUTHORS Saussez,S., Cucu,D.R., Decaestecker,C., Chevalier,D., Kaltner,H.,
Andre,S., Wacreniez,A., Toubeau,G., Camby,I., Gabius,H.J. and
Kiss,R.
TITLE Galectin 7 (p53-induced gene 1): a new prognostic predictor of
recurrence and survival in stage IV hypopharyngeal cancer
JOURNAL Ann. Surg. Oncol. 13 (7), 999-1009 (2006)
PUBMED 16788763
REFERENCE 3 (bases 1 to 506)
AUTHORS Kopitz,J., Andre,S., von Reitzenstein,C., Versluis,K., Kaltner,H.,
Pieters,R.J., Wasano,K., Kuwabara,I., Liu,F.T., Cantz,M., Heck,A.J.
and Gabius,H.J.
TITLE Homodimeric galectin-7 (p53-induced gene 1) is a negative growth
regulator for human neuroblastoma cells
JOURNAL Oncogene 22 (40), 6277-6288 (2003)
PUBMED 13679866
REFERENCE 4 (bases 1 to 506)
AUTHORS Kuwabara,I., Kuwabara,Y., Yang,R.Y., Schuler,M., Green,D.R.,
Zuraw,B.L., Hsu,D.K. and Liu,F.T.
TITLE Galectin-7 (PIG1) exhibits pro-apoptotic function through JNK
activation and mitochondrial cytochrome c release
JOURNAL J. Biol. Chem. 277 (5), 3487-3497 (2002)
PUBMED 11706006
REFERENCE 5 (bases 1 to 506)
AUTHORS Leonidas,D.D., Vatzaki,E.H., Vorum,H., Celis,J.E., Madsen,P. and
Acharya,K.R.
TITLE Structural basis for the recognition of carbohydrates by human
galectin-7
JOURNAL Biochemistry 37 (40), 13930-13940 (1998)
PUBMED 9760227
REFERENCE 6 (bases 1 to 506)
AUTHORS Magnaldo,T., Bernerd,F. and Darmon,M.
TITLE Galectin-7, a human 14-kDa S-lectin, specifically expressed in
keratinocytes and sensitive to retinoic acid
JOURNAL Dev. Biol. 168 (2), 259-271 (1995)
PUBMED 7729568
REFERENCE 7 (bases 1 to 506)
AUTHORS Madsen,P., Rasmussen,H.H., Flint,T., Gromov,P., Kruse,T.A.,
Honore,B., Vorum,H. and Celis,J.E.
TITLE Cloning, expression, and chromosome mapping of human galectin-7
JOURNAL J. Biol. Chem. 270 (11), 5823-5829 (1995)
PUBMED 7534301
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from L07769.1, AW015224.1 and
BC042911.2.
On Jul 30, 2008 this sequence version replaced gi:163659852.
Summary: The galectins are a family of beta-galactoside-binding
proteins implicated in modulating cell-cell and cell-matrix
interactions. Differential and in situ hybridization studies
indicate that this lectin is specifically expressed in
keratinocytes and found mainly in stratified squamous epithelium. A
duplicate copy of this gene (GeneID:3963) is found adjacent to, but
on the opposite strand on chromosome 19. [provided by RefSeq, Jul
2008].
##Evidence-Data-START##
Transcript exon combination :: BM020432.1, BU536530.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025085 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-43 L07769.1 2-44
44-483 AW015224.1 17-456 c
484-506 BC042911.2 460-482
FEATURES Location/Qualifiers
source 1..506
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.2"
gene 1..506
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/note="lectin, galactoside-binding, soluble, 7B"
/db_xref="GeneID:653499"
/db_xref="HGNC:34447"
exon 1..23
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/inference="alignment:Splign:1.39.8"
CDS 18..428
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/note="keratinocyte lectin 14; p53-induced protein 1;
lectin galactoside-binding soluble 7; galectin-7B;
galectin 7B; p53-induced gene 1 protein"
/codon_start=1
/product="galectin-7"
/protein_id="NP_001035972.1"
/db_xref="GI:109948279"
/db_xref="CCDS:CCDS42565.1"
/db_xref="GeneID:653499"
/db_xref="HGNC:34447"
/translation="
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
"
misc_feature 30..416
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/note="Galectin/galactose-binding lectin. This domain
exclusively binds beta-galactosides, such as lactose, and
does not require metal ions for activity. GLECT domains
occur as homodimers or tandemly repeated domains. They are
developmentally regulated and may...; Region: GLECT;
cd00070"
/db_xref="CDD:28952"
misc_feature order(33..47,402..416)
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/note="dimerization interface [polypeptide binding]; other
site"
/db_xref="CDD:28952"
misc_feature 33..47
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/note="dimerization swap strand; other site"
/db_xref="CDD:28952"
misc_feature order(60..68,75..77,84..86,291..299,312..314,318..320,
327..329)
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/note="putative alternate dimerization interface
[polypeptide binding]; other site"
/db_xref="CDD:28952"
misc_feature order(165..167,171..173,177..179,198..200,204..206,
225..227,234..236,240..242)
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/note="sugar binding pocket [chemical binding]; other
site"
/db_xref="CDD:28952"
misc_feature 225..245
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P47929.2);
Region: Beta-galactoside binding (Potential)"
exon 24..112
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/inference="alignment:Splign:1.39.8"
variation 44
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="a"
/replace="g"
/db_xref="dbSNP:9238"
variation 44
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="a"
/replace="g"
/db_xref="dbSNP:201263690"
variation 61
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="a"
/replace="c"
/db_xref="dbSNP:867728"
variation 86
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="c"
/replace="t"
/db_xref="dbSNP:200262818"
exon 113..314
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/inference="alignment:Splign:1.39.8"
variation 119
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="g"
/replace="t"
/db_xref="dbSNP:190577097"
variation 161
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="c"
/replace="g"
/db_xref="dbSNP:1052554"
variation 161
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="c"
/replace="g"
/db_xref="dbSNP:183137923"
variation 173
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="c"
/replace="t"
/db_xref="dbSNP:371961194"
variation 176
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="a"
/replace="c"
/db_xref="dbSNP:4700"
variation 176
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="a"
/replace="c"
/db_xref="dbSNP:56351361"
variation 178
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="a"
/replace="g"
/db_xref="dbSNP:367816015"
STS 194..431
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/standard_name="RH80063"
/db_xref="UniSTS:91678"
STS 197..344
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/standard_name="RH66782"
/db_xref="UniSTS:55229"
variation 258
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/replace="c"
/replace="t"
/db_xref="dbSNP:371753738"
exon 315..489
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
/inference="alignment:Splign:1.39.8"
polyA_signal 465..470
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
polyA_site 488
/gene="LGALS7B"
/gene_synonym="Gal-7; GAL7; HKL-14; LGALS7; PI7"
ORIGIN
ccaacccggtcccagccatgtccaacgtcccccacaagtcctcactgcccgagggcatccgccctggcacggtgctgagaattcgcggcttggttcctcccaatgccagcaggttccatgtaaacctgctgtgcggggaggagcagggctccgatgccgccctgcatttcaacccccggctggacacgtcggaggtggtcttcaacagcaaggagcaaggctcctggggccgcgaggagcgcgggccgggcgttcctttccagcgcgggcagcccttcgaggtgctcatcatcgcgtcagacgacggcttcaaggccgtggttggggacgcccagtaccaccacttccgccaccgcctgccgctggcgcgcgtgcgcctggtggaggtgggcggggacgtgcagctggactccgtgaggatcttctgagcagaagcccaggcgggcccggggccttggctggcaaataaagcgttagcccgcagcgcgaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:653499 -> Molecular function: GO:0030246 [carbohydrate binding] evidence: IEA
GeneID:653499 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:653499 -> Biological process: GO:0007157 [heterophilic cell-cell adhesion] evidence: TAS
GeneID:653499 -> Cellular component: GO:0005615 [extracellular space] evidence: TAS
GeneID:653499 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:653499 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.