2024-04-25 03:53:01, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001039664 894 bp mRNA linear PRI 11-MAY-2013 DEFINITION Homo sapiens tumor necrosis factor receptor superfamily, member 25 (TNFRSF25), transcript variant 12, mRNA. ACCESSION NM_001039664 VERSION NM_001039664.1 GI:89142744 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 894) AUTHORS Schreiber,T.H., Wolf,D., Bodero,M., Gonzalez,L. and Podack,E.R. TITLE T cell costimulation by TNFR superfamily (TNFRSF)4 and TNFRSF25 in the context of vaccination JOURNAL J. Immunol. 189 (7), 3311-3318 (2012) PUBMED 22956587 REMARK GeneRIF: Both TNFRSF25 and TNFRSF4 independently and additively costimulate vaccine-induced CD8+ T cell proliferation following both primary and secondary antigen challenge. REFERENCE 2 (bases 1 to 894) AUTHORS Wang,W., Zhang,N., Zhu,X.H., He,Z.S., Wahafu,W., Xu,Z.Q. and Yang,Y. TITLE Involvement of TL1A and DR3 in induction of ischaemia and inflammation in urinary bladder dysfunction in the elderly JOURNAL Mol Med Rep 6 (2), 434-438 (2012) PUBMED 22641456 REMARK GeneRIF: Protein expression of tumour necrosis factor (TNF)-like ligand 1A (TL1A) and death-domain receptor (DR)3 is upregulated in the aged bladder tissues. REFERENCE 3 (bases 1 to 894) AUTHORS Park,M.H., Song,M.J., Cho,M.C., Moon,D.C., Yoon do,Y., Han,S.B. and Hong,J.T. TITLE Interleukin-32 enhances cytotoxic effect of natural killer cells to cancer cells via activation of death receptor 3 JOURNAL Immunology 135 (1), 63-72 (2012) PUBMED 22043900 REMARK GeneRIF: It was shown that IL-32 enhanced the cytotoxic effect of natural killer cells on protate cancer cells through activation of DR3 and caspase-3. REFERENCE 4 (bases 1 to 894) AUTHORS Bamias,G., Evangelou,K., Vergou,T., Tsimaratou,K., Kaltsa,G., Antoniou,C., Kotsinas,A., Kim,S., Gorgoulis,V., Stratigos,A.J. and Sfikakis,P.P. TITLE Upregulation and nuclear localization of TNF-like cytokine 1A (TL1A) and its receptors DR3 and DcR3 in psoriatic skin lesions JOURNAL Exp. Dermatol. 20 (9), 725-731 (2011) PUBMED 21672030 REMARK GeneRIF: in active psoriasis, we observed abundant immunostaining for TL1A and significant upregulation of its receptors DR3 and DcR3 REFERENCE 5 (bases 1 to 894) AUTHORS Porquet,N., Poirier,A., Houle,F., Pin,A.L., Gout,S., Tremblay,P.L., Paquet,E.R., Klinck,R., Auger,F.A. and Huot,J. TITLE Survival advantages conferred to colon cancer cells by E-selectin-induced activation of the PI3K-NFkappaB survival axis downstream of Death receptor-3 JOURNAL BMC Cancer 11, 285 (2011) PUBMED 21722370 REMARK GeneRIF: Investigated further the mechanisms by which the E-selectin-activated pathways downstream of DR3 confer a survival advantage to colon cancer cells. Publication Status: Online-Only REFERENCE 6 (bases 1 to 894) AUTHORS Screaton,G.R., Xu,X.N., Olsen,A.L., Cowper,A.E., Tan,R., McMichael,A.J. and Bell,J.I. TITLE LARD: a new lymphoid-specific death domain containing receptor regulated by alternative pre-mRNA splicing JOURNAL Proc. Natl. Acad. Sci. U.S.A. 94 (9), 4615-4619 (1997) PUBMED 9114039 REFERENCE 7 (bases 1 to 894) AUTHORS Bodmer,J.L., Burns,K., Schneider,P., Hofmann,K., Steiner,V., Thome,M., Bornand,T., Hahne,M., Schroter,M., Becker,K., Wilson,A., French,L.E., Browning,J.L., MacDonald,H.R. and Tschopp,J. TITLE TRAMP, a novel apoptosis-mediating receptor with sequence homology to tumor necrosis factor receptor 1 and Fas(Apo-1/CD95) JOURNAL Immunity 6 (1), 79-88 (1997) PUBMED 9052839 REFERENCE 8 (bases 1 to 894) AUTHORS Marsters,S.A., Sheridan,J.P., Donahue,C.J., Pitti,R.M., Gray,C.L., Goddard,A.D., Bauer,K.D. and Ashkenazi,A. TITLE Apo-3, a new member of the tumor necrosis factor receptor family, contains a death domain and activates apoptosis and NF-kappa B JOURNAL Curr. Biol. 6 (12), 1669-1676 (1996) PUBMED 8994832 REFERENCE 9 (bases 1 to 894) AUTHORS Kitson,J., Raven,T., Jiang,Y.P., Goeddel,D.V., Giles,K.M., Pun,K.T., Grinham,C.J., Brown,R. and Farrow,S.N. TITLE A death-domain-containing receptor that mediates apoptosis JOURNAL Nature 384 (6607), 372-375 (1996) PUBMED 8934525 REFERENCE 10 (bases 1 to 894) AUTHORS Chinnaiyan,A.M., O'Rourke,K., Yu,G.L., Lyons,R.H., Garg,M., Duan,D.R., Xing,L., Gentz,R., Ni,J. and Dixit,V.M. TITLE Signal transduction by DR3, a death domain-containing receptor related to TNFR-1 and CD95 JOURNAL Science 274 (5289), 990-992 (1996) PUBMED 8875942 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AY358309.1 and U83598.1. Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (12) lacks several 3' exons and has an alternate 3' end, when compared to variant 1. The resulting isoform (12) has a distinct and shorter C-terminus, as compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U94512.1, U83598.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025089 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-104 AY358309.1 15-118 105-685 U83598.1 1-581 686-894 U83598.1 583-791 FEATURES Location/Qualifiers source 1..894 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1p36.2" gene 1..894 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /note="tumor necrosis factor receptor superfamily, member 25" /db_xref="GeneID:8718" /db_xref="HGNC:11910" /db_xref="MIM:603366" exon 1..127 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /inference="alignment:Splign:1.39.8" variation 12..15 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /replace="" /replace="ggcg" /db_xref="dbSNP:45542640" variation 46..53 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /replace="" /replace="agagcacg" /db_xref="dbSNP:45616733" CDS 89..634 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /note="isoform 12 precursor is encoded by transcript variant 12; tumor necrosis factor receptor superfamily, member 12 (translocating chain-association membrane protein); death domain receptor 3 soluble form; death receptor beta; apoptosis inducing receptor; protein WSL-1; apoptosis-inducing receptor AIR; apoptosis-mediating receptor DR3; apoptosis-mediating receptor TRAMP; lymphocyte-associated receptor of death" /codon_start=1 /product="tumor necrosis factor receptor superfamily member 25 isoform 12 precursor" /protein_id="NP_001034753.1" /db_xref="GI:89142745" /db_xref="GeneID:8718" /db_xref="HGNC:11910" /db_xref="MIM:603366" /translation="
MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPT
" sig_peptide 89..160 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 161..631 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /product="tumor necrosis factor receptor superfamily member 25 isoform 12" misc_feature 188..301 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q93038.2); Region: TNFR-Cys 1" misc_feature 191..454 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /note="Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains. When bound to TNF-like cytokines, TNFRs trigger multiple signal transduction pathways, they are involved in inflammation response, apoptosis, autoimmunity and...; Region: TNFR; cl12111" /db_xref="CDD:209448" misc_feature order(191..196,320..322,356..358,389..391) /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /note="antiparallel homodimerization interface [polypeptide binding]; other site" /db_xref="CDD:29147" misc_feature order(203..205,233..235,245..247,251..253,293..295, 302..304,332..334) /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /note="parallel homodimerization interface [polypeptide binding]; other site" /db_xref="CDD:29147" misc_feature order(233..262,290..304,410..418) /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /note="protein binding site [polypeptide binding]; other site" /db_xref="CDD:29147" misc_feature 302..433 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q93038.2); Region: TNFR-Cys 2" misc_feature order(329..334,353..361) /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /note="50's loop TNF binding site; other site" /db_xref="CDD:29147" misc_feature 434..577 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q93038.2); Region: TNFR-Cys 3" exon 128..248 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /inference="alignment:Splign:1.39.8" STS 174..347 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /standard_name="RH12587" /db_xref="UniSTS:56414" exon 249..383 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /inference="alignment:Splign:1.39.8" variation 274 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /replace="a" /replace="g" /db_xref="dbSNP:45438594" exon 384..551 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /inference="alignment:Splign:1.39.8" variation 460 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /replace="a" /replace="g" /db_xref="dbSNP:45497599" variation 475 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /replace="a" /replace="g" /db_xref="dbSNP:3170675" exon 552..894 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /inference="alignment:Splign:1.39.8" variation 698 /gene="TNFRSF25" /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR" /replace="a" /replace="c" /db_xref="dbSNP:45599832" ORIGIN
cgggccctgcgggcgcggggctgaaggcggaaccacgacgggcagagagcacggagccgggaagcccctgggcgcccgtcggagggctatggagcagcggccgcggggctgcgcggcggtggcggcggcgctcctcctggtgctgctgggggcccgggcccagggcggcactcgtagccccaggtgtgactgtgccggtgacttccacaagaagattggtctgttttgttgcagaggctgcccagcggggcactacctgaaggccccttgcacggagccctgcggcaactccacctgccttgtgtgtccccaagacaccttcttggcctgggagaaccaccataattctgaatgtgcccgctgccaggcctgtgatgagcaggcctcccaggtggcgctggagaactgttcagcagtggccgacacccgctgtggctgtaagccaggctggtttgtggagtgccaggtcagccaatgtgtcagcagttcacccttctactgccaaccatgcctagactgcggggccctgcaccgccacacacggctactctgttcccgcagagatactgactgtgggacctgcctgcctggcttctatgaacatggcgatggctgcgtgtcctgccccacgtaattcctagctgtcgtgggatggagggaagggcggctgggagcagagcaggggcctggggtggggcaggtgctgctggttcaggaataggaagaggggatagggaggagggagccttggccctgtgatgggtgggccccacttcaggcaaacttagatggcaaaagagcaatctggatccgccttagccagatacataagggtatttgccttcactttcagccagcattccccccagcgatcctagccagatattacagatg
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:8718 -> Molecular function: GO:0004872 [receptor activity] evidence: NAS GeneID:8718 -> Molecular function: GO:0005031 [tumor necrosis factor-activated receptor activity] evidence: TAS GeneID:8718 -> Biological process: GO:0006915 [apoptotic process] evidence: NAS GeneID:8718 -> Biological process: GO:0006917 [induction of apoptosis] evidence: TAS GeneID:8718 -> Biological process: GO:0007165 [signal transduction] evidence: TAS GeneID:8718 -> Biological process: GO:0007166 [cell surface receptor signaling pathway] evidence: TAS GeneID:8718 -> Biological process: GO:0033209 [tumor necrosis factor-mediated signaling pathway] evidence: TAS GeneID:8718 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: NAS GeneID:8718 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS GeneID:8718 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA GeneID:8718 -> Cellular component: GO:0005829 [cytosol] evidence: NAS GeneID:8718 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA GeneID:8718 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.