GGRNA Home | Help | Advanced search

2024-04-25 03:53:01, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001039664             894 bp    mRNA    linear   PRI 11-MAY-2013
DEFINITION  Homo sapiens tumor necrosis factor receptor superfamily, member 25
            (TNFRSF25), transcript variant 12, mRNA.
ACCESSION   NM_001039664
VERSION     NM_001039664.1  GI:89142744
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 894)
  AUTHORS   Schreiber,T.H., Wolf,D., Bodero,M., Gonzalez,L. and Podack,E.R.
  TITLE     T cell costimulation by TNFR superfamily (TNFRSF)4 and TNFRSF25 in
            the context of vaccination
  JOURNAL   J. Immunol. 189 (7), 3311-3318 (2012)
   PUBMED   22956587
  REMARK    GeneRIF: Both TNFRSF25 and TNFRSF4 independently and additively
            costimulate vaccine-induced CD8+ T cell proliferation following
            both primary and secondary antigen challenge.
REFERENCE   2  (bases 1 to 894)
  AUTHORS   Wang,W., Zhang,N., Zhu,X.H., He,Z.S., Wahafu,W., Xu,Z.Q. and
            Yang,Y.
  TITLE     Involvement of TL1A and DR3 in induction of ischaemia and
            inflammation in urinary bladder dysfunction in the elderly
  JOURNAL   Mol Med Rep 6 (2), 434-438 (2012)
   PUBMED   22641456
  REMARK    GeneRIF: Protein expression of tumour necrosis factor (TNF)-like
            ligand 1A (TL1A) and death-domain receptor (DR)3 is upregulated in
            the aged bladder tissues.
REFERENCE   3  (bases 1 to 894)
  AUTHORS   Park,M.H., Song,M.J., Cho,M.C., Moon,D.C., Yoon do,Y., Han,S.B. and
            Hong,J.T.
  TITLE     Interleukin-32 enhances cytotoxic effect of natural killer cells to
            cancer cells via activation of death receptor 3
  JOURNAL   Immunology 135 (1), 63-72 (2012)
   PUBMED   22043900
  REMARK    GeneRIF: It was shown that IL-32 enhanced the cytotoxic effect of
            natural killer cells on protate cancer cells through activation of
            DR3 and caspase-3.
REFERENCE   4  (bases 1 to 894)
  AUTHORS   Bamias,G., Evangelou,K., Vergou,T., Tsimaratou,K., Kaltsa,G.,
            Antoniou,C., Kotsinas,A., Kim,S., Gorgoulis,V., Stratigos,A.J. and
            Sfikakis,P.P.
  TITLE     Upregulation and nuclear localization of TNF-like cytokine 1A
            (TL1A) and its receptors DR3 and DcR3 in psoriatic skin lesions
  JOURNAL   Exp. Dermatol. 20 (9), 725-731 (2011)
   PUBMED   21672030
  REMARK    GeneRIF: in active psoriasis, we observed abundant immunostaining
            for TL1A and significant upregulation of its receptors DR3 and DcR3
REFERENCE   5  (bases 1 to 894)
  AUTHORS   Porquet,N., Poirier,A., Houle,F., Pin,A.L., Gout,S., Tremblay,P.L.,
            Paquet,E.R., Klinck,R., Auger,F.A. and Huot,J.
  TITLE     Survival advantages conferred to colon cancer cells by
            E-selectin-induced activation of the PI3K-NFkappaB survival axis
            downstream of Death receptor-3
  JOURNAL   BMC Cancer 11, 285 (2011)
   PUBMED   21722370
  REMARK    GeneRIF: Investigated further the mechanisms by which the
            E-selectin-activated pathways downstream of DR3 confer a survival
            advantage to colon cancer cells.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 894)
  AUTHORS   Screaton,G.R., Xu,X.N., Olsen,A.L., Cowper,A.E., Tan,R.,
            McMichael,A.J. and Bell,J.I.
  TITLE     LARD: a new lymphoid-specific death domain containing receptor
            regulated by alternative pre-mRNA splicing
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 94 (9), 4615-4619 (1997)
   PUBMED   9114039
REFERENCE   7  (bases 1 to 894)
  AUTHORS   Bodmer,J.L., Burns,K., Schneider,P., Hofmann,K., Steiner,V.,
            Thome,M., Bornand,T., Hahne,M., Schroter,M., Becker,K., Wilson,A.,
            French,L.E., Browning,J.L., MacDonald,H.R. and Tschopp,J.
  TITLE     TRAMP, a novel apoptosis-mediating receptor with sequence homology
            to tumor necrosis factor receptor 1 and Fas(Apo-1/CD95)
  JOURNAL   Immunity 6 (1), 79-88 (1997)
   PUBMED   9052839
REFERENCE   8  (bases 1 to 894)
  AUTHORS   Marsters,S.A., Sheridan,J.P., Donahue,C.J., Pitti,R.M., Gray,C.L.,
            Goddard,A.D., Bauer,K.D. and Ashkenazi,A.
  TITLE     Apo-3, a new member of the tumor necrosis factor receptor family,
            contains a death domain and activates apoptosis and NF-kappa B
  JOURNAL   Curr. Biol. 6 (12), 1669-1676 (1996)
   PUBMED   8994832
REFERENCE   9  (bases 1 to 894)
  AUTHORS   Kitson,J., Raven,T., Jiang,Y.P., Goeddel,D.V., Giles,K.M.,
            Pun,K.T., Grinham,C.J., Brown,R. and Farrow,S.N.
  TITLE     A death-domain-containing receptor that mediates apoptosis
  JOURNAL   Nature 384 (6607), 372-375 (1996)
   PUBMED   8934525
REFERENCE   10 (bases 1 to 894)
  AUTHORS   Chinnaiyan,A.M., O'Rourke,K., Yu,G.L., Lyons,R.H., Garg,M.,
            Duan,D.R., Xing,L., Gentz,R., Ni,J. and Dixit,V.M.
  TITLE     Signal transduction by DR3, a death domain-containing receptor
            related to TNFR-1 and CD95
  JOURNAL   Science 274 (5289), 990-992 (1996)
   PUBMED   8875942
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AY358309.1 and U83598.1.
            
            Summary: The protein encoded by this gene is a member of the
            TNF-receptor superfamily. This receptor is expressed preferentially
            in the tissues enriched in lymphocytes, and it may play a role in
            regulating lymphocyte homeostasis. This receptor has been shown to
            stimulate NF-kappa B activity and regulate cell apoptosis. The
            signal transduction of this receptor is mediated by various death
            domain containing adaptor proteins. Knockout studies in mice
            suggested the role of this gene in the removal of self-reactive T
            cells in the thymus. Multiple alternatively spliced transcript
            variants of this gene encoding distinct isoforms have been
            reported, most of which are potentially secreted molecules. The
            alternative splicing of this gene in B and T cells encounters a
            programmed change upon T-cell activation, which predominantly
            produces full-length, membrane bound isoforms, and is thought to be
            involved in controlling lymphocyte proliferation induced by T-cell
            activation. [provided by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (12) lacks several 3' exons and
            has an alternate 3' end, when compared to variant 1. The resulting
            isoform (12) has a distinct and shorter C-terminus, as compared to
            isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U94512.1, U83598.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025087, ERS025089 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-104               AY358309.1         15-118
            105-685             U83598.1           1-581
            686-894             U83598.1           583-791
FEATURES             Location/Qualifiers
     source          1..894
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p36.2"
     gene            1..894
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /note="tumor necrosis factor receptor superfamily, member
                     25"
                     /db_xref="GeneID:8718"
                     /db_xref="HGNC:11910"
                     /db_xref="MIM:603366"
     exon            1..127
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /inference="alignment:Splign:1.39.8"
     variation       12..15
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /replace=""
                     /replace="ggcg"
                     /db_xref="dbSNP:45542640"
     variation       46..53
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /replace=""
                     /replace="agagcacg"
                     /db_xref="dbSNP:45616733"
     CDS             89..634
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /note="isoform 12 precursor is encoded by transcript
                     variant 12; tumor necrosis factor receptor superfamily,
                     member 12 (translocating chain-association membrane
                     protein); death domain receptor 3 soluble form; death
                     receptor beta; apoptosis inducing receptor; protein WSL-1;
                     apoptosis-inducing receptor AIR; apoptosis-mediating
                     receptor DR3; apoptosis-mediating receptor TRAMP;
                     lymphocyte-associated receptor of death"
                     /codon_start=1
                     /product="tumor necrosis factor receptor superfamily
                     member 25 isoform 12 precursor"
                     /protein_id="NP_001034753.1"
                     /db_xref="GI:89142745"
                     /db_xref="GeneID:8718"
                     /db_xref="HGNC:11910"
                     /db_xref="MIM:603366"
                     /translation="
MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPT
"
     sig_peptide     89..160
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     161..631
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /product="tumor necrosis factor receptor superfamily
                     member 25 isoform 12"
     misc_feature    188..301
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q93038.2);
                     Region: TNFR-Cys 1"
     misc_feature    191..454
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /note="Tumor necrosis factor receptor (TNFR) domain;
                     superfamily of TNF-like receptor domains. When bound to
                     TNF-like cytokines, TNFRs trigger multiple signal
                     transduction pathways, they are involved in inflammation
                     response, apoptosis, autoimmunity and...; Region: TNFR;
                     cl12111"
                     /db_xref="CDD:209448"
     misc_feature    order(191..196,320..322,356..358,389..391)
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /note="antiparallel homodimerization interface
                     [polypeptide binding]; other site"
                     /db_xref="CDD:29147"
     misc_feature    order(203..205,233..235,245..247,251..253,293..295,
                     302..304,332..334)
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /note="parallel homodimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:29147"
     misc_feature    order(233..262,290..304,410..418)
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:29147"
     misc_feature    302..433
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q93038.2);
                     Region: TNFR-Cys 2"
     misc_feature    order(329..334,353..361)
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /note="50's loop TNF binding site; other site"
                     /db_xref="CDD:29147"
     misc_feature    434..577
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q93038.2);
                     Region: TNFR-Cys 3"
     exon            128..248
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /inference="alignment:Splign:1.39.8"
     STS             174..347
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /standard_name="RH12587"
                     /db_xref="UniSTS:56414"
     exon            249..383
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /inference="alignment:Splign:1.39.8"
     variation       274
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:45438594"
     exon            384..551
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /inference="alignment:Splign:1.39.8"
     variation       460
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:45497599"
     variation       475
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3170675"
     exon            552..894
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /inference="alignment:Splign:1.39.8"
     variation       698
                     /gene="TNFRSF25"
                     /gene_synonym="APO-3; DDR3; DR3; LARD; TNFRSF12; TR3;
                     TRAMP; WSL-1; WSL-LR"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:45599832"
ORIGIN      
cgggccctgcgggcgcggggctgaaggcggaaccacgacgggcagagagcacggagccgggaagcccctgggcgcccgtcggagggctatggagcagcggccgcggggctgcgcggcggtggcggcggcgctcctcctggtgctgctgggggcccgggcccagggcggcactcgtagccccaggtgtgactgtgccggtgacttccacaagaagattggtctgttttgttgcagaggctgcccagcggggcactacctgaaggccccttgcacggagccctgcggcaactccacctgccttgtgtgtccccaagacaccttcttggcctgggagaaccaccataattctgaatgtgcccgctgccaggcctgtgatgagcaggcctcccaggtggcgctggagaactgttcagcagtggccgacacccgctgtggctgtaagccaggctggtttgtggagtgccaggtcagccaatgtgtcagcagttcacccttctactgccaaccatgcctagactgcggggccctgcaccgccacacacggctactctgttcccgcagagatactgactgtgggacctgcctgcctggcttctatgaacatggcgatggctgcgtgtcctgccccacgtaattcctagctgtcgtgggatggagggaagggcggctgggagcagagcaggggcctggggtggggcaggtgctgctggttcaggaataggaagaggggatagggaggagggagccttggccctgtgatgggtgggccccacttcaggcaaacttagatggcaaaagagcaatctggatccgccttagccagatacataagggtatttgccttcactttcagccagcattccccccagcgatcctagccagatattacagatg
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:8718 -> Molecular function: GO:0004872 [receptor activity] evidence: NAS
            GeneID:8718 -> Molecular function: GO:0005031 [tumor necrosis factor-activated receptor activity] evidence: TAS
            GeneID:8718 -> Biological process: GO:0006915 [apoptotic process] evidence: NAS
            GeneID:8718 -> Biological process: GO:0006917 [induction of apoptosis] evidence: TAS
            GeneID:8718 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
            GeneID:8718 -> Biological process: GO:0007166 [cell surface receptor signaling pathway] evidence: TAS
            GeneID:8718 -> Biological process: GO:0033209 [tumor necrosis factor-mediated signaling pathway] evidence: TAS
            GeneID:8718 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: NAS
            GeneID:8718 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS
            GeneID:8718 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA
            GeneID:8718 -> Cellular component: GO:0005829 [cytosol] evidence: NAS
            GeneID:8718 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
            GeneID:8718 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.