GGRNA Home | Help | Advanced search

2019-03-23 03:03:58, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001030047            1906 bp    mRNA    linear   PRI 24-JUN-2013
DEFINITION  Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript
            variant 3, mRNA.
ACCESSION   NM_001030047
VERSION     NM_001030047.1  GI:71834852
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1906)
  AUTHORS   Helfand,B.T., Loeb,S., Hu,Q., Cooper,P.R., Roehl,K.A.,
            McGuire,B.B., Baumann,N.A. and Catalona,W.J.
  TITLE     Personalized prostate specific antigen testing using genetic
            variants may reduce unnecessary prostate biopsies
  JOURNAL   J. Urol. 189 (5), 1697-1701 (2013)
   PUBMED   23246478
  REMARK    GeneRIF: Our results suggest that 4 single nucleotide polymorphisms
            can be used to adjust a man's measured prostate specific antigen
            concentration and potentially delay or prevent unnecessary prostate
            biopsies in Caucasian men
REFERENCE   2  (bases 1 to 1906)
  AUTHORS   Shobana,R., Samal,S.K. and Elankumaran,S.
  TITLE     Prostate-specific antigen-retargeted recombinant newcastle disease
            virus for prostate cancer virotherapy
  JOURNAL   J. Virol. 87 (7), 3792-3800 (2013)
   PUBMED   23345509
  REMARK    GeneRIF: Prostate-specific antigen targeting is likely to enhance
            the therapeutic index of recombinant Newcastle disease virus in
            prostate cancer, owing to tumor-restricted replication and enhanced
            fusogenicity.
REFERENCE   3  (bases 1 to 1906)
  AUTHORS   Sun,J., Tao,S., Gao,Y., Peng,T., Tan,A., Zhang,H., Yang,X., Qin,X.,
            Hu,Y., Feng,J., Kim,S.T., Lin,X., Wu,Y., Zhang,J., Li,Z., Li,L.,
            Mo,L., Liang,Z., Shi,D., Huang,Z., Huang,X., Liu,M., Liu,Q.,
            Zhang,S., Lilly Zheng,S., Xu,J. and Mo,Z.
  TITLE     Genome-wide association study identified novel genetic variant on
            SLC45A3 gene associated with serum levels prostate-specific antigen
            (PSA) in a Chinese population
  JOURNAL   Hum. Genet. 132 (4), 423-429 (2013)
   PUBMED   23269536
  REMARK    GeneRIF: Genome-wide association study identified novel genetic
            variant on SLC45A3 gene associated with serum levels
            prostate-specific antigen (PSA) in a Chinese population.
REFERENCE   4  (bases 1 to 1906)
  AUTHORS   Higashibata,T., Naito,M., Mori,A., Ozawa,N., Furuta,M.,
            Tsuchiya,R., Koyama,E., Morita,E., Kawai,S., Okada,R., Yin,G.,
            Wakai,K. and Hamajima,N.
  TITLE     DPP4 genetic variants influence baseline prostate-specific antigen
            levels: the J-MICC study
  JOURNAL   Nagoya J Med Sci 75 (1-2), 73-80 (2013)
   PUBMED   23544270
  REMARK    GeneRIF: DPP4 genetic variants influence baseline PSA levels,
            especially in men aged between 60 and 69.
REFERENCE   5  (bases 1 to 1906)
  AUTHORS   Samzadeh,M., Hasanzad,M., Jamaldini,S.H., Haghdoost,A.A.,
            Afshari,M. and Ziaee,S.A.
  TITLE     Association of G/A polymorphism, rs266882, in AREI region of the
            prostate-specific antigen gene with prostate cancer risk and
            clinicopathological features
  JOURNAL   Urol J 9 (4), 691-699 (2012)
   PUBMED   23235975
  REMARK    GeneRIF: We found a significant positive association between the GG
            genotype of PSA polymorphism and prostate cancer risk compared to
            AG genotype. But no association was observed between alleles and
            grade, stage, or age of diagnosis.
REFERENCE   6  (bases 1 to 1906)
  AUTHORS   Cohen,P., Graves,H.C., Peehl,D.M., Kamarei,M., Giudice,L.C. and
            Rosenfeld,R.G.
  TITLE     Prostate-specific antigen (PSA) is an insulin-like growth factor
            binding protein-3 protease found in seminal plasma
  JOURNAL   J. Clin. Endocrinol. Metab. 75 (4), 1046-1053 (1992)
   PUBMED   1383255
REFERENCE   7  (bases 1 to 1906)
  AUTHORS   Espana,F., Gilabert,J., Estelles,A., Romeu,A., Aznar,J. and Cabo,A.
  TITLE     Functionally active protein C inhibitor/plasminogen activator
            inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at
            high concentrations in human seminal plasma and complexes with
            prostate-specific antigen
  JOURNAL   Thromb. Res. 64 (3), 309-320 (1991)
   PUBMED   1725227
REFERENCE   8  (bases 1 to 1906)
  AUTHORS   Christensson,A., Laurell,C.B. and Lilja,H.
  TITLE     Enzymatic activity of prostate-specific antigen and its reactions
            with extracellular serine proteinase inhibitors
  JOURNAL   Eur. J. Biochem. 194 (3), 755-763 (1990)
   PUBMED   1702714
REFERENCE   9  (bases 1 to 1906)
  AUTHORS   Lundwall,A. and Lilja,H.
  TITLE     Molecular cloning of human prostate specific antigen cDNA
  JOURNAL   FEBS Lett. 214 (2), 317-322 (1987)
   PUBMED   2436946
REFERENCE   10 (bases 1 to 1906)
  AUTHORS   Watt,K.W., Lee,P.J., M'Timkulu,T., Chan,W.P. and Loor,R.
  TITLE     Human prostate-specific antigen: structural and functional
            similarity with serine proteases
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 83 (10), 3166-3170 (1986)
   PUBMED   2422647
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC005307.1, M21896.1 and
            AC011523.3.
            
            Summary: Kallikreins are a subgroup of serine proteases having
            diverse physiological functions. Growing evidence suggests that
            many kallikreins are implicated in carcinogenesis and some have
            potential as novel cancer and other disease biomarkers. This gene
            is one of the fifteen kallikrein subfamily members located in a
            cluster on chromosome 19. Its protein product is a protease present
            in seminal plasma. It is thought to function normally in the
            liquefaction of seminal coagulum, presumably by hydrolysis of the
            high molecular mass seminal vesicle protein. Serum level of this
            protein, called PSA in the clinical setting, is useful in the
            diagnosis and monitoring of prostatic carcinoma. Alternate splicing
            of this gene generates several transcript variants encoding
            different isoforms. [provided by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (3) uses an alternate splice site
            at the end of a coding exon, that causes a frameshift. The
            resulting isoform (3) is shorter and has a distinct C-terminus
            compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BU932434.1, M21896.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-52                BC005307.1         1-52
            53-911              M21896.1           1-859
            912-1906            AC011523.3         28192-29186
FEATURES             Location/Qualifiers
     source          1..1906
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.41"
     gene            1..1906
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /note="kallikrein-related peptidase 3"
                     /db_xref="GeneID:354"
                     /db_xref="HGNC:6364"
                     /db_xref="HPRD:01461"
                     /db_xref="MIM:176820"
     exon            1..87
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /inference="alignment:Splign:1.39.8"
     variation       3
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371797932"
     variation       17
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370025467"
     variation       25
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199680464"
     variation       40
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373854842"
     CDS             42..758
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /EC_number="3.4.21.77"
                     /note="isoform 3 preproprotein is encoded by transcript
                     variant 3; gamma-seminoprotein; semenogelase; seminin;
                     P-30 antigen; prostate-specific antigen; prostate specific
                     antigen; kallikrein-3"
                     /codon_start=1
                     /product="prostate-specific antigen isoform 3
                     preproprotein"
                     /protein_id="NP_001025218.1"
                     /db_xref="GI:71834853"
                     /db_xref="CCDS:CCDS33083.1"
                     /db_xref="GeneID:354"
                     /db_xref="HGNC:6364"
                     /db_xref="HPRD:01461"
                     /db_xref="MIM:176820"
                     /translation="
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSWVILITELTMPALPMVLHGSLVPWRGGV
"
     sig_peptide     42..92
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     proprotein      93..755
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /product="prostate-specific antigen isoform 3 proprotein"
     mat_peptide     114..755
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /product="prostate-specific antigen isoform 3"
     misc_feature    114..>671
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:29152"
     misc_feature    114..116
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /note="cleavage site"
                     /db_xref="CDD:29152"
     misc_feature    order(234..236,399..401)
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /note="active site"
                     /db_xref="CDD:29152"
     variation       50
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201712212"
     variation       52
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111689449"
     variation       53
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375104394"
     variation       67
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368127664"
     variation       73
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138400533"
     exon            88..247
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /inference="alignment:Splign:1.39.8"
     variation       89..90
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17849961"
     variation       89
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11573"
     variation       91
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181375335"
     variation       95
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1135766"
     variation       111
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141576693"
     variation       112
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147446084"
     variation       115
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375110405"
     variation       122
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200846924"
     variation       134
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139911579"
     variation       135
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2271092"
     variation       157
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200712655"
     variation       158
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7252245"
     variation       169
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:140318583"
     variation       170
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374094231"
     variation       175
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139560851"
     variation       183
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149709822"
     variation       187..188
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34953540"
     variation       191
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144294681"
     variation       194..195
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace=""
                     /replace="ggg"
                     /db_xref="dbSNP:375428882"
     variation       194
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201710884"
     variation       195
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369223448"
     variation       237
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371595805"
     exon            248..534
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /inference="alignment:Splign:1.39.8"
     variation       255
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148892721"
     variation       263
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150517791"
     variation       270
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146422657"
     variation       271
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140831892"
     variation       278
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12946"
     variation       279
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17849962"
     variation       300
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138565183"
     STS             331..437
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /standard_name="PMC290276P4"
                     /db_xref="UniSTS:272424"
     variation       341
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2739452"
     variation       344
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374344392"
     variation       345
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61752561"
     variation       398
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377532899"
     variation       411
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201390347"
     variation       414
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61750343"
     variation       431
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201110725"
     variation       432
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182759459"
     variation       435
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2003783"
     variation       439
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373661565"
     variation       447
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149427770"
     variation       488
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147547638"
     variation       500
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376483907"
     variation       501
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138273452"
     variation       503..504
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:370161423"
     variation       519
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200126385"
     variation       525
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112372888"
     variation       530
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143868213"
     exon            535..671
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /inference="alignment:Splign:1.39.8"
     variation       541
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367976209"
     variation       548..549
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:111850120"
     variation       566
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202206082"
     variation       569
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148735869"
     variation       572
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372190695"
     variation       577
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17632542"
     variation       587
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372148450"
     variation       588
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150769385"
     variation       596
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376510386"
     variation       615
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376934756"
     variation       629
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139172057"
     variation       641
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1803129"
     variation       644
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370658603"
     variation       646
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187449592"
     variation       647
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:191588971"
     variation       649
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146528783"
     variation       670
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61729813"
     exon            672..1906
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /inference="alignment:Splign:1.39.8"
     variation       689
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35192866"
     variation       690
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73932617"
     variation       695
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148839360"
     variation       712
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199786442"
     variation       713
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371037518"
     variation       732
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143518180"
     variation       786
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:10401479"
     variation       793
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201907046"
     variation       799
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368022457"
     variation       807
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200639337"
     variation       827
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:10401978"
     variation       841
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:45588133"
     variation       869..870
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:113002491"
     variation       912
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2659122"
     STS             995..1117
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /standard_name="D19S1013"
                     /db_xref="UniSTS:68940"
     variation       1002
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3209092"
     variation       1117
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151298874"
     variation       1146
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140564011"
     variation       1163
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138882542"
     variation       1164
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61736309"
     variation       1172
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200116262"
     variation       1182
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79245399"
     variation       1192
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:144118163"
     variation       1194
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146297845"
     variation       1195
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372901531"
     variation       1203
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:45552633"
     variation       1209
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113126792"
     variation       1228
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1802720"
     variation       1232
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149376489"
     variation       1250
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144748315"
     variation       1254
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375475599"
     variation       1255
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200006942"
     variation       1284
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1058205"
     variation       1294
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373134993"
     variation       1299
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374859717"
     STS             1301..1531
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /standard_name="RH17676"
                     /db_xref="UniSTS:80100"
     variation       1308
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368035787"
     variation       1319
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112479005"
     variation       1328
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141498977"
     variation       1334
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1058274"
     variation       1346
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1803132"
     variation       1358
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1802722"
     variation       1360
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1141894"
     variation       1386
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116064912"
     variation       1393
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1802721"
     variation       1405
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116248649"
     variation       1406
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3180906"
     variation       1431
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16987771"
     variation       1457
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1803138"
     STS             1506..1670
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /standard_name="KLK3"
                     /db_xref="UniSTS:480246"
     variation       1510
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190504941"
     variation       1514
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12101"
     variation       1547
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6998"
     variation       1567..1568
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:112363170"
     variation       1575
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:16987775"
     variation       1651
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1803136"
     variation       1669
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1803135"
     variation       1677
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370827372"
     variation       1682
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:193123776"
     variation       1684
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377210991"
     variation       1689
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1803134"
     variation       1713
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12040"
     variation       1729
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61269009"
     variation       1766
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1803133"
     variation       1773
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11554029"
     variation       1784
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12863"
     variation       1803
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1803137"
     variation       1808
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11554028"
     variation       1858
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11554027"
     polyA_signal    1885..1890
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
     polyA_site      1906
                     /gene="KLK3"
                     /gene_synonym="APS; hK3; KLK2A1; PSA"
ORIGIN      
agccccaagcttaccacctgcacccggagagctgtgtcaccatgtgggtcccggttgtcttcctcaccctgtccgtgacgtggattggtgctgcacccctcatcctgtctcggattgtgggaggctgggagtgcgagaagcattcccaaccctggcaggtgcttgtggcctctcgtggcagggcagtctgcggcggtgttctggtgcacccccagtgggtcctcacagctgcccactgcatcaggaacaaaagcgtgatcttgctgggtcggcacagcctgtttcatcctgaagacacaggccaggtatttcaggtcagccacagcttcccacacccgctctacgatatgagcctcctgaagaatcgattcctcaggccaggtgatgactccagccacgacctcatgctgctccgcctgtcagagcctgccgagctcacggatgctgtgaaggtcatggacctgcccacccaggagccagcactggggaccacctgctacgcctcaggctggggcagcattgaaccagaggagttcttgaccccaaagaaacttcagtgtgtggacctccatgttatttccaatgacgtgtgtgcgcaagttcaccctcagaaggtgaccaagttcatgctgtgtgctggacgctggacagggggcaaaagcacctgctcgtgggtcattctgatcaccgaactgaccatgccagccctgccgatggtcctccatggctccctagtgccctggagaggaggtgtctagtcagagagtagtcctggaaggtggcctctgtgaggagccacggggacagcatcctgcagatggtcctggcccttgtcccaccgacctgtctacaaggactgtcctcgtggaccctcccctctgcacaggagctggaccctgaagtcccttccccaccggccaggactggagcccctacccctctgttggaatccctgcccaccttcttctggaagtcggctctggagacatttctctcttcttccaaagctgggaactgctatctgttatctgcctgtccaggtctgaaagataggattgcccaggcagaaactgggactgacctatctcactctctccctgcttttacccttagggtgattctgggggcccacttgtctgtaatggtgtgcttcaaggtatcacgtcatggggcagtgaaccatgtgccctgcccgaaaggccttccctgtacaccaaggtggtgcattaccggaagtggatcaaggacaccatcgtggccaacccctgagcacccctatcaaccccctattgtagtaaacttggaaccttggaaatgaccaggccaagactcaagcctccccagttctactgacctttgtccttaggtgtgaggtccagggttgctaggaaaagaaatcagcagacacaggtgtagaccagagtgtttcttaaatggtgtaattttgtcctctctgtgtcctggggaatactggccatgcctggagacatatcactcaatttctctgaggacacagataggatggggtgtctgtgttatttgtggggtacagagatgaaagaggggtgggatccacactgagagagtggagagtgacatgtgctggacactgtccatgaagcactgagcagaagctggaggcacaacgcaccagacactcacagcaaggatggagctgaaaacataacccactctgtcctggaggcactgggaagcctagagaaggctgtgagccaaggagggagggtcttcctttggcatgggatggggatgaagtaaggagagggactggaccccctggaagctgattcactatggggggaggtgtattgaagtcctccagacaaccctcagatttgatgatttcctagtagaactcacagaaataaagagctgttatactgtg
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:354 -> Molecular function: GO:0004252 [serine-type endopeptidase activity] evidence: NAS
            GeneID:354 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:354 -> Molecular function: GO:0008236 [serine-type peptidase activity] evidence: TAS
            GeneID:354 -> Biological process: GO:0006508 [proteolysis] evidence: NAS
            GeneID:354 -> Biological process: GO:0016525 [negative regulation of angiogenesis] evidence: NAS
            GeneID:354 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS
            GeneID:354 -> Cellular component: GO:0005576 [extracellular region] evidence: NAS
            GeneID:354 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_001025218 -> EC 3.4.21.77

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.