Home |
Help |
Advanced search
2024-04-25 04:58:12, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001029863 4219 bp mRNA linear PRI 18-APR-2013
DEFINITION Homo sapiens chromosome 6 open reading frame 120 (C6orf120), mRNA.
ACCESSION NM_001029863
VERSION NM_001029863.1 GI:71143155
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 4219)
AUTHORS Li,X., Qiao,Y., Chang,L.S., Xiao,F., Lu,L.H., Hao,X.H., Zhang,R.W.,
Wu,H. and Wei,H.S.
TITLE Role of C6ORF120, an N-glycosylated protein, is implicated in
apoptosis of CD4(+) T lymphocytes
JOURNAL Chin. Med. J. 124 (21), 3560-3567 (2011)
PUBMED 22340178
REMARK GeneRIF: Results suggested that C6ORF120 could induce apoptosis of
CD4(+) T cells, at least in part, mediated with endoplasmic
reticulum stress.
REFERENCE 2 (bases 1 to 4219)
AUTHORS Bradfield,J.P., Qu,H.Q., Wang,K., Zhang,H., Sleiman,P.M., Kim,C.E.,
Mentch,F.D., Qiu,H., Glessner,J.T., Thomas,K.A., Frackelton,E.C.,
Chiavacci,R.M., Imielinski,M., Monos,D.S., Pandey,R., Bakay,M.,
Grant,S.F., Polychronakos,C. and Hakonarson,H.
TITLE A genome-wide meta-analysis of six type 1 diabetes cohorts
identifies multiple associated loci
JOURNAL PLoS Genet. 7 (9), E1002293 (2011)
PUBMED 21980299
REFERENCE 3 (bases 1 to 4219)
AUTHORS Rogner,U.C., Heiss,N.S., Kioschis,P., Wiemann,S., Korn,B. and
Poustka,A.
TITLE Transcriptional analysis of the candidate region for incontinentia
pigmenti (IP2) in Xq28
JOURNAL Genome Res. 6 (10), 922-934 (1996)
PUBMED 8908511
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from BC051700.1.
##Evidence-Data-START##
Transcript exon combination :: BC051700.1 [ECO:0000332]
##Evidence-Data-END##
FEATURES Location/Qualifiers
source 1..4219
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6q27"
gene 1..4219
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/note="chromosome 6 open reading frame 120"
/db_xref="GeneID:387263"
/db_xref="HGNC:21247"
exon 1..4146
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/inference="alignment:Splign:1.39.8"
variation 8
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:185807629"
variation 11
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:4716383"
variation 20
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:141767157"
variation 60..61
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="cactgc"
/db_xref="dbSNP:200117070"
variation 62..63
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="ctgccc"
/db_xref="dbSNP:372182758"
variation 62
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="c"
/db_xref="dbSNP:373935520"
variation 72
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:372586600"
variation 112
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:377368563"
misc_feature 117..119
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/note="upstream in-frame stop codon"
variation 119
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="c"
/db_xref="dbSNP:13200077"
variation 246
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:190483655"
variation 248
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:72571025"
variation 261
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:180745807"
variation 278
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:200955655"
variation 279
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:185358680"
variation 293
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="g"
/replace="t"
/db_xref="dbSNP:368439208"
CDS 300..875
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/note="UPF0669 protein C6orf120"
/codon_start=1
/product="UPF0669 protein C6orf120 precursor"
/protein_id="NP_001025034.1"
/db_xref="GI:71143156"
/db_xref="CCDS:CCDS34575.1"
/db_xref="GeneID:387263"
/db_xref="HGNC:21247"
/translation="
MAAPRGRAAPWTTALLLLLASQVLSPGSCADEEEVPEEWVLLHVVQGQIGAGNYSYLRLNHEGKIVLRMRSLKGDADLYVSASSLHPSFDDYELQSATCGPDAVSIPAHFRRPVGIGVYGHPSHLESEFEMKVYYDGTVEQHPFGEAAYPADGADAGQKHAGAPEDASQEEESVLWTILISILKLVLEILF
"
sig_peptide 300..389
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 390..872
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/product="UPF0669 protein C6orf120"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q7Z4R8.1)"
variation 315
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:201930179"
variation 353
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:370823465"
variation 359
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:148067109"
variation 377
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:113807887"
variation 398
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:200215521"
variation 423
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:377523211"
variation 428
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:145958223"
variation 482
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:370267053"
variation 492
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:139874883"
variation 502
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:202010557"
variation 503
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:143772098"
variation 513
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:181431563"
variation 527
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:373681738"
variation 532
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:368741434"
variation 561
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:372141955"
variation 597
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:374320617"
variation 625
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:144803739"
variation 631
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:199570268"
variation 649
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:201427999"
variation 654
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="t"
/db_xref="dbSNP:148582871"
variation 660
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201907552"
variation 710
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:142998748"
variation 714
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:151116596"
variation 717
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:116084833"
variation 735
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:144632729"
variation 736
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="t"
/db_xref="dbSNP:147895716"
variation 752
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:369929805"
variation 794
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:41265393"
variation 806
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:150834883"
variation 819
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:373615188"
variation 867
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:377593831"
variation 885..886
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="ca"
/db_xref="dbSNP:150288859"
variation 886..887
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="ac"
/db_xref="dbSNP:370131159"
variation 905
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:192022566"
variation 910..911
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="at"
/db_xref="dbSNP:367893787"
variation 914
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:138303623"
variation 956..959
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="ttgg"
/db_xref="dbSNP:372062156"
variation 970
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:113643510"
variation 1019
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:143888444"
variation 1020
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="t"
/db_xref="dbSNP:183783243"
variation 1041
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:147277916"
variation 1140
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:187260913"
variation 1146
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:140885693"
variation 1252..1253
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="t"
/db_xref="dbSNP:5881838"
variation 1254
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="t"
/db_xref="dbSNP:200015159"
variation 1296
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:374173056"
variation 1365
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="c"
/db_xref="dbSNP:377582741"
variation 1380
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:149834038"
variation 1386
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="c"
/db_xref="dbSNP:111452450"
variation 1416
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:192009047"
variation 1488
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="g"
/replace="t"
/db_xref="dbSNP:144838471"
variation 1655..1656
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="a"
/db_xref="dbSNP:34283211"
variation 1661
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:374882177"
variation 1687..1688
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="a"
/db_xref="dbSNP:200244638"
variation 1740
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="g"
/replace="t"
/db_xref="dbSNP:17860603"
variation 1757
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="t"
/db_xref="dbSNP:182069716"
variation 1805
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:371983940"
variation 1816
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376263590"
variation 1837
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:369139294"
variation 1842
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="t"
/db_xref="dbSNP:200839862"
variation 1845
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="c"
/db_xref="dbSNP:371748920"
variation 1846
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201833587"
variation 1894
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:138612904"
variation 1902
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:376447866"
variation 1925
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:148902304"
variation 1961
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="c"
/db_xref="dbSNP:370407642"
variation 2018
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:117299617"
variation 2085
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="a"
/db_xref="dbSNP:71787122"
variation 2169
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:142980828"
variation 2172
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:146409224"
variation 2211
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:186660616"
variation 2213..2214
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="t"
/db_xref="dbSNP:368149620"
variation 2234
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:140825392"
variation 2281
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:367818167"
variation 2339
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:371630339"
variation 2372
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:191654793"
variation 2414
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:143235860"
STS 2432..2605
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/standard_name="D6S1237E"
/db_xref="UniSTS:39174"
variation 2457
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:146706178"
variation 2643
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:371851951"
variation 2747
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:182665528"
variation 2786
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375749587"
variation 2801
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="g"
/replace="t"
/db_xref="dbSNP:140331004"
variation 2854
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:41265395"
variation 2865..2866
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="a"
/db_xref="dbSNP:375523720"
variation 2868
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="g"
/replace="t"
/db_xref="dbSNP:372449544"
variation 2882
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:113275655"
variation 2949
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:369970938"
variation 3014
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:199609575"
variation 3041
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:143578587"
variation 3057
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:138138680"
variation 3122
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:373802598"
variation 3172
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="t"
/db_xref="dbSNP:7759105"
variation 3189
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375561143"
STS 3256..3380
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/standard_name="RH36593"
/db_xref="UniSTS:47464"
variation 3264
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:73039197"
variation 3297
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:80250989"
variation 3410
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="c"
/db_xref="dbSNP:369940135"
variation 3419
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:371636901"
variation 3424
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:373616681"
variation 3448
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:150361706"
variation 3469
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:4286788"
variation 3481
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:200825555"
variation 3494
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:4557522"
variation 3543
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:373121095"
variation 3552
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="g"
/db_xref="dbSNP:144617367"
variation 3558
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:138574457"
variation 3573
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:377234354"
variation 3595
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="g"
/replace="t"
/db_xref="dbSNP:369544131"
variation 3720
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:149100717"
variation 3725
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="c"
/db_xref="dbSNP:369691797"
variation 3742
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="g"
/replace="t"
/db_xref="dbSNP:9371169"
variation 3783
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:143185653"
variation 3825
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="c"
/db_xref="dbSNP:193059290"
STS 3838..4120
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/standard_name="D6S1902"
/db_xref="UniSTS:9681"
variation 3926..3929
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="actt"
/db_xref="dbSNP:5881839"
variation 3929..3932
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="tact"
/db_xref="dbSNP:35892429"
variation 4017
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:75557160"
variation 4031
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:80278708"
variation 4063
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="t"
/db_xref="dbSNP:3924590"
variation 4114
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="c"
/replace="t"
/db_xref="dbSNP:185238646"
variation 4121
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:143848302"
variation 4131
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace="a"
/replace="g"
/db_xref="dbSNP:190482358"
variation 4144..4145
/gene="C6orf120"
/gene_synonym="bA160E12.4"
/replace=""
/replace="tt"
/db_xref="dbSNP:373331512"
ORIGIN
ggatgtataaggcgcggccccctgcggggagtggtggtgagtccgagggtgccacagcggccctgcccctgcccctgcccctgccctgagtgggcgccgcgctacgggggaggggttaacccacccctcctccccggggcctcacgcgggtgggaagggacagtcccagcgacagaccaggcgcctggacgcgccgtggacccgcgtgcggacggcggggacaggctccggtgctgagcgcctccggtgtccccagcagcactgacccacttgcaggccccggagctgagccgccagccatggccgctccccgcgggagggccgcgccctggacgacggccctgctgctgctcctagcctcgcaggtcctgtctccgggaagctgcgcggacgaggaggaggtccccgaggagtgggtgctcctgcacgtcgtccagggccagataggcgccgggaactacagctacctgcggctgaaccacgagggcaagatagtcctcaggatgcgcagcctcaagggagatgcggatctgtacgtctccgccagcagcctgcaccccagcttcgacgactacgagctgcaatcggccacctgcggcccggacgccgtgtccatccccgcgcacttccggcgcccagtgggcatcggcgtctatggacacccctcccacctggagagcgagttcgagatgaaggtgtactacgacggcacggtcgagcagcacccgttcggcgaggccgcctaccccgccgacggcgcagatgccggccagaagcacgctggtgccccggaagacgcctcgcaagaggaggaatctgttctctggacgatattaattagcattttgaaactggtacttgaaattctcttttgagtcgttgaccacactctgggatataaaaccctccatctgtgaagctgattgcagtttgctgtgaaccttgctacttgtacttggttgaagttctaggtacctttagtcaagggatggaaaaataaagccatacgcagttttgttacctcagttacccaaaaaataggaaaagcagcaagcacagtattttaaagatcataattcctataaaaggactgtgcacaaagtgtttagactccattttcattaggcaggttgactaaaaatgattgcagtaacaggtttatataaaatagagcaacctttcatgctgtgacacaaatcaaaaggttgataactttgtaattttactctggagattctaaccgaagttggtgtaagttttcaagagttactaaaatcaagttggaaatgatttacgtacacttccctgagcctggactaaagcctcatgcctgtaccccaagtaggtgatggtacttttctatacaaaaaggatttcctggcaggcaggtatttacaaagtttgttcctgtaccagtccaataatgacaactctaaatccagctgcaccaaatcttagtgggccatttgtcatacctatgaaaattcttcagttattaaataactttgtcagtgctacctatggtaggccggaaacaatgtagattaggaagtttcatgaaaattaacttttggggctatggagaaacagttaagtatcttaagttactaaacatttccactgaatttttggagtgagccaaggttactataaaatactttggaagatgaattctctacctggagttagtttcgagagtaagcgtagcttttaacagaaataactgcagattttaagctcataatttgcaaaaaaaatcttttattggcatgaaaataatgttgtaaatggcaccaaatattccacttaaatgcatatacagtattagagtcaaaaactattttatccctctttgctgtttttcccccttctgcccactttcctgggtgttgggggggcccgctgacaacagtcacaaatccagcgacctaggaaaaaaattgttaatatagaatgaaaaattatctttacaggactgaattttaagcccatctaaactcttctgccttagctatcactaatgatattcctctctggattttgtggtgagaagggcactatgagttccttaatttaaggaaaaaatgtaaacttaatcaatgtaatcaatgccatgcaaaattcattgcaagtcaagggggatgggagagatgcaatgccatacggtgatacggacctttaagaaagtacaatctttcctgaaattcaaacactatcatacttcaaaaggtcaaaacccattccggaatttggcttttttaagactttttctctcctgctcactggcagctgtgtgtcttaacagcattctttcaagtcctggtgtactctgctgacagcactttaaaactttaacagcacaatgataacttgtactacatacttgatctgaattactacagaaaaataattatgttgcttgcttaatgattcccaggaaacttcgttgtaggcatatattttataagagtattatacagtgttaactatgcaagtaagttctaaaattacacaattatctgtgtaatgttttagtccaattactgtgatttattcaactctgttctaaagttatctggaattgtcatgctgcctcaatttacagaaatctataatagatttctatagaaatgtataaagacgtagcagtcattttgttgtttctaaatagataacatataaaaataaaggctttgttactttagtatttcagtagaaaaacaccagctcattctatagaactatacttccaaaacttagcaggggcattctggcctttcacttatcctttagttggaattgtctagggatgaaaagctggtggacatgacctgtataatcacagctttggtcatatttgcacataagagtccacaagctcttcatgtcatgatagcgtttatgcagccttttggagtgctgggagagtctcatcacccaaagataatgtttgctctttttttaatctttacctgatggaatagcaccaaggcccacacaaaaagtatgataacctctgtcacacatatcacagaacatcatttcttcttcatggtggggttgtccacatataatgcatgttttacattccatacactgccatgggtaggtcttaatcatagaaacaagctccattgtcatatccaggcaagaaggatggcctaaatcaaaaccagtattagtggtatctcacataagaaattttaacttaatatggcacataaaatactagtttgctttaggacttccagagaatggctataatgtcaaatcgccaaagagaaatgaatatacaatgtagaggaaaacacatgggctgtgtctatgcctcacaagctaccctgtgtatttaatttggtgactctttggttgaaatctgcctgaaactataaattctagtttttgaaccgataaatacggtggttaaaattttaaaaagacatttcaatacttaccactattctcacattgggagcagtgtataagtgattcagcctttcctttcttgttggactccttacccttcagacaaattccacatatagcatttggaatgacctttggctggaagggtagaagagggctataaattcatgccagaagagcttactatgggtttaaaaggaattctgttactttattgccctatttttacttttggtaacttgctaatgaggaccattttgaaagacaaaacttgacaggagtctgcctacaatgtaagactgcctactgaagaaagcattaatttcatcataaaatttggtaaacagcatgatctcgtaagattaaatgtagcattctatactccctacatgcacagtaagatttgtttaatgaatggaaggaaagactaaatacaatgtcaaatgtcactattaattggacaagaaaatccaagtagcaaatgaccattatgtgtaagacttactctaaaaagaccattttaaatagctcatatattaattttgtttaaaacctgctattttccaaaactgcaaaactagagctataaaatctaagttaaaaaatcagcttatcctcattggtatagtggtatttaaaaaaaaatcagtttaaacatttttaattgaaagatgtctcatgcatacattggcgtgtacataaacgtttgtggaaaacttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:387263 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:387263 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.