Home |
Help |
Advanced search
2024-04-20 08:49:22, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001014835 2379 bp mRNA linear PRI 02-JUN-2013
DEFINITION Homo sapiens p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4),
transcript variant 4, mRNA.
ACCESSION NM_001014835
VERSION NM_001014835.1 GI:62422562
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2379)
AUTHORS Kim,S.H., Kim,S.R., Ihm,H.J., Oh,Y.S., Chae,H.D., Kim,C.H. and
Kang,B.M.
TITLE Regulation of P21-activated kinase-4 by progesterone and tumor
necrosis factor-alpha in human endometrium and its increased
expression in advanced-stage endometriosis
JOURNAL J. Clin. Endocrinol. Metab. 98 (2), E238-E248 (2013)
PUBMED 23293332
REMARK GeneRIF: increased expression of Pak4 might lead to the
establishment and progression of endometriosis by enhanced cellular
viability and invasiveness in endometrial cells.
REFERENCE 2 (bases 1 to 2379)
AUTHORS Wang,Z., Zhang,X., Yang,Z., Du,H., Wu,Z., Gong,J., Yan,J. and
Zheng,Q.
TITLE MiR-145 regulates PAK4 via the MAPK pathway and exhibits an
antitumor effect in human colon cells
JOURNAL Biochem. Biophys. Res. Commun. 427 (3), 444-449 (2012)
PUBMED 22766504
REMARK GeneRIF: these findings demonstrate that miR-145 downregulates
P-ERK expression by targeting PAK4 and leads to inhibition of tumor
growth.
REFERENCE 3 (bases 1 to 2379)
AUTHORS Ha,B.H., Davis,M.J., Chen,C., Lou,H.J., Gao,J., Zhang,R.,
Krauthammer,M., Halaban,R., Schlessinger,J., Turk,B.E. and
Boggon,T.J.
TITLE Type II p21-activated kinases (PAKs) are regulated by an
autoinhibitory pseudosubstrate
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 109 (40), 16107-16112 (2012)
PUBMED 22988085
REMARK GeneRIF: Full-length PAK4 is constitutively autoinibited, but
mutation of the pseudosubstrate releases this inhibition.
REFERENCE 4 (bases 1 to 2379)
AUTHORS Baskaran,Y., Ng,Y.W., Selamat,W., Ling,F.T. and Manser,E.
TITLE Group I and II mammalian PAKs have different modes of activation by
Cdc42
JOURNAL EMBO Rep. 13 (7), 653-659 (2012)
PUBMED 22653441
REMARK GeneRIF: PAK4 is strongly inhibited by an auto-inhibitory domain
formed by amino acids 20 to 68.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 2379)
AUTHORS Kesanakurti,D., Chetty,C., Rajasekhar Maddirela,D., Gujrati,M. and
Rao,J.S.
TITLE Functional cooperativity by direct interaction between PAK4 and
MMP-2 in the regulation of anoikis resistance, migration and
invasion in glioma
JOURNAL Cell Death Dis 3, E445 (2012)
PUBMED 23254288
REMARK GeneRIF: Interaction between PAK4 and MMP-2 regulated anoikis, cell
migration and invasion in glioma.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 2379)
AUTHORS Lu,Y., Pan,Z.Z., Devaux,Y. and Ray,P.
TITLE p21-activated protein kinase 4 (PAK4) interacts with the
keratinocyte growth factor receptor and participates in
keratinocyte growth factor-mediated inhibition of oxidant-induced
cell death
JOURNAL J. Biol. Chem. 278 (12), 10374-10380 (2003)
PUBMED 12529371
REMARK GeneRIF: PAK4 interacts with KGF receptor and mediate
anti-apoptosis effects of KGF on epithelial cells.
REFERENCE 7 (bases 1 to 2379)
AUTHORS Zhang,H., Li,Z., Viklund,E.K. and Stromblad,S.
TITLE P21-activated kinase 4 interacts with integrin alpha v beta 5 and
regulates alpha v beta 5-mediated cell migration
JOURNAL J. Cell Biol. 158 (7), 1287-1297 (2002)
PUBMED 12356872
REFERENCE 8 (bases 1 to 2379)
AUTHORS Dan,C., Kelly,A., Bernard,O. and Minden,A.
TITLE Cytoskeletal changes regulated by the PAK4 serine/threonine kinase
are mediated by LIM kinase 1 and cofilin
JOURNAL J. Biol. Chem. 276 (34), 32115-32121 (2001)
PUBMED 11413130
REFERENCE 9 (bases 1 to 2379)
AUTHORS Bagrodia,S. and Cerione,R.A.
TITLE Pak to the future
JOURNAL Trends Cell Biol. 9 (9), 350-355 (1999)
PUBMED 10461188
REMARK Review article
REFERENCE 10 (bases 1 to 2379)
AUTHORS Abo,A., Qu,J., Cammarano,M.S., Dan,C., Fritsch,A., Baud,V.,
Belisle,B. and Minden,A.
TITLE PAK4, a novel effector for Cdc42Hs, is implicated in the
reorganization of the actin cytoskeleton and in the formation of
filopodia
JOURNAL EMBO J. 17 (22), 6527-6540 (1998)
PUBMED 9822598
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BG773480.1 and AB032968.1.
Summary: PAK proteins, a family of serine/threonine p21-activating
kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are
critical effectors that link Rho GTPases to cytoskeleton
reorganization and nuclear signaling. They serve as targets for the
small GTP binding proteins Cdc42 and Rac and have been implicated
in a wide range of biological activities. PAK4 interacts
specifically with the GTP-bound form of Cdc42Hs and weakly
activates the JNK family of MAP kinases. PAK4 is a mediator of
filopodia formation and may play a role in the reorganization of
the actin cytoskeleton. Multiple alternatively spliced transcript
variants encoding distinct isoforms have been found for this gene.
[provided by RefSeq, Jul 2008].
Transcript Variant: This variant (4) lacks an in-frame exon in the
coding region, as compared to variant 1. The encoded isoform (2)
thus lacks an internal segment, as compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AB032968.1 [ECO:0000332]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-54 BG773480.1 26-79
55-2379 AB032968.1 1-2325
FEATURES Location/Qualifiers
source 1..2379
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.2"
gene 1..2379
/gene="PAK4"
/note="p21 protein (Cdc42/Rac)-activated kinase 4"
/db_xref="GeneID:10298"
/db_xref="HGNC:16059"
/db_xref="MIM:605451"
exon 1..140
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 56
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:71356837"
variation 74
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:4803205"
variation 102
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:4803206"
variation 116
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:111999288"
exon 141..213
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
misc_feature 146..148
/gene="PAK4"
/note="upstream in-frame stop codon"
variation 151
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:144636460"
variation 155
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:45495801"
variation 182
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:373493871"
variation 193
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:73933813"
exon 214..439
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 216
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376621337"
variation 217
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:370008929"
variation 221
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:690929"
variation 222
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:201511246"
variation 224
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:149068416"
variation 229
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:373760840"
variation 230
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:376606539"
CDS 236..1552
/gene="PAK4"
/EC_number="2.7.11.1"
/note="isoform 2 is encoded by transcript variant 4;
protein kinase related to S. cerevisiae STE20, effector
for Cdc42Hs; p21(CDKN1A)-activated kinase 4;
serine/threonine-protein kinase PAK 4; PAK-4;
p21-activated kinase 4"
/codon_start=1
/product="serine/threonine-protein kinase PAK 4 isoform 2"
/protein_id="NP_001014835.1"
/db_xref="GI:62422563"
/db_xref="CCDS:CCDS33019.1"
/db_xref="GeneID:10298"
/db_xref="HGNC:16059"
/db_xref="MIM:605451"
/translation="
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACITSIQPGAPKGEPHDVAPNGPSAGGLAIPQSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
"
misc_feature 263..379
/gene="PAK4"
/note="PAK (p21 activated kinase) Binding Domain (PBD),
binds Cdc42p- and/or Rho-like small GTPases; also known as
the Cdc42/Rac interactive binding (CRIB) motif; has been
shown to inhibit transcriptional activation and cell
transformation mediated by the...; Region: CRIB_PAK_like;
cd01093"
/db_xref="CDD:29038"
misc_feature order(266..268,275..277,284..286,290..292,299..301,
350..352,362..364)
/gene="PAK4"
/note="GTPase interaction site [polypeptide binding];
other site"
/db_xref="CDD:29038"
misc_feature 356..358
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O96013.1); phosphorylation site"
misc_feature 548..550
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:05675"
misc_feature 647..649
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:05675"
misc_feature 677..1531
/gene="PAK4"
/note="Catalytic domain of the Protein Serine/Threonine
Kinase, Group II p21-activated kinase; Region:
STKc_PAK_II; cd06648"
/db_xref="CDD:132979"
misc_feature 752..1492
/gene="PAK4"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(755..769,779..781,818..820,824..826,851..853,
911..913,959..973,977..982,989..991,1094..1096,1100..1111,
1115..1117,1145..1150,1157..1159,1196..1210,1214..1216,
1295..1297,1322..1330)
/gene="PAK4"
/note="active site"
/db_xref="CDD:132979"
misc_feature order(755..769,779..781,818..820,824..826,911..913,
959..973,977..982,989..991,1106..1111,1115..1117,
1145..1150)
/gene="PAK4"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:132979"
misc_feature order(764..769,851..853,1094..1096,1100..1108,1157..1159,
1196..1210,1214..1216,1295..1297,1322..1330)
/gene="PAK4"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:132979"
misc_feature 1145..1216
/gene="PAK4"
/note="activation loop (A-loop); other site"
/db_xref="CDD:132979"
misc_feature 1196..1198
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 1208..1210
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:05675"
variation 271
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:370966374"
variation 273
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:146498509"
variation 277
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:141017388"
variation 280
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:200199299"
variation 282
/gene="PAK4"
/replace=""
/replace="a"
/db_xref="dbSNP:66579155"
variation 283
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:199730416"
variation 295
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:114564484"
variation 296
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:146583353"
variation 304
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:199597836"
variation 310
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:113813881"
variation 319
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:75096376"
variation 364
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:373656030"
variation 365
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:200500244"
variation 394
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:377525201"
variation 395
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:148292608"
variation 399
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:112229040"
variation 409
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:200638581"
variation 427
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:141602417"
variation 430
/gene="PAK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:371051871"
variation 431
/gene="PAK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:373324891"
variation 432
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376845802"
exon 440..874
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 440
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:370852872"
variation 444
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:371684690"
variation 445
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:138516359"
variation 446
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375872670"
variation 455
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:200391013"
variation 483
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:368557621"
variation 488
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:371973365"
variation 519
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:199929260"
variation 544
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375137743"
variation 550
/gene="PAK4"
/replace=""
/replace="c"
/db_xref="dbSNP:35120836"
variation 596
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:200534045"
variation 611
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:369318453"
variation 613
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:190702581"
variation 644
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375957288"
STS 670..966
/gene="PAK4"
/standard_name="MARC_20651-20652:1024691026:1"
/db_xref="UniSTS:268460"
variation 715
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:369018322"
variation 722
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:143998317"
variation 724
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201587224"
variation 729
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:147291859"
variation 757
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:374237195"
variation 760
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:371904272"
variation 790
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:370908993"
variation 794
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:140420249"
variation 804
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:149267288"
variation 805
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:144457438"
variation 820
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:148400225"
exon 875..1008
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 902
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:375220515"
variation 925
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:146831773"
variation 930
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:142488595"
variation 943
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:368459616"
variation 985
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:56306494"
variation 991
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559035"
variation 993
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:146517848"
variation 994
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:372653621"
exon 1009..1135
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 1015
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376504839"
variation 1033
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:139956496"
variation 1034
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:370017586"
variation 1054
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:374443098"
variation 1062
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:377696830"
variation 1063
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:116665223"
variation 1072
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:371674508"
variation 1091
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375117492"
variation 1099
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:146720735"
variation 1102
/gene="PAK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:11559036"
variation 1105
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:141004307"
exon 1136..1261
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 1142
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559033"
variation 1188
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:373414547"
variation 1198
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:56286946"
variation 1199
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559034"
variation 1204
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201757969"
variation 1237
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:200775475"
variation 1242
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:147024501"
variation 1247
/gene="PAK4"
/replace=""
/replace="c"
/db_xref="dbSNP:34054211"
variation 1249
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:138564503"
variation 1252
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:144059751"
exon 1262..1396
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 1276
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:151137853"
variation 1280
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:193920877"
variation 1307
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:141267072"
variation 1317
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:368539931"
variation 1318
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:146955542"
variation 1327
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375810830"
variation 1328
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:372098486"
variation 1348
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:111768373"
variation 1354
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:11559037"
variation 1378
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:201791285"
exon 1397..2379
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 1428
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:200026990"
variation 1438
/gene="PAK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:34569811"
variation 1439
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:56084716"
variation 1462
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:55747949"
variation 1469
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:150747591"
variation 1493
/gene="PAK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:149210444"
variation 1560
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:371711789"
variation 1588
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376520116"
variation 1648
/gene="PAK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:113335516"
variation 1661
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:186511166"
variation 1724
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:377438234"
variation 1725
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:143251867"
variation 1805
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:3752161"
variation 1833
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:79890280"
variation 1834
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:45573536"
variation 1848
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:374106536"
variation 1933..1934
/gene="PAK4"
/replace=""
/replace="tg"
/db_xref="dbSNP:3833875"
variation 1934..1935
/gene="PAK4"
/replace=""
/replace="tg"
/db_xref="dbSNP:373786885"
variation 1935..1936
/gene="PAK4"
/replace=""
/replace="gt"
/db_xref="dbSNP:142481159"
variation 1946..1947
/gene="PAK4"
/replace=""
/replace="tg"
/db_xref="dbSNP:67439622"
variation 1975
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:13228"
variation 1998
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:114113304"
variation 2026..2027
/gene="PAK4"
/replace=""
/replace="c"
/db_xref="dbSNP:34766623"
variation 2071
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559032"
variation 2089..2090
/gene="PAK4"
/replace=""
/replace="tt"
/db_xref="dbSNP:377017717"
variation 2121
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:114754037"
variation 2182
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559031"
STS 2224..2350
/gene="PAK4"
/standard_name="RH12716"
/db_xref="UniSTS:3224"
variation 2313
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:73933820"
variation 2320
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:11122"
variation 2324
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:45472902"
variation 2341
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:370782442"
polyA_signal 2356..2361
/gene="PAK4"
variation 2364
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:181552710"
polyA_site 2373
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
polyA_site 2375
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
polyA_site 2379
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
agccccggatgttcgttggggattcaacatggcggcgggagtgtccgcggtggtggcggtgcaagagagctgagggaggcgcgagggcgcggagttccaggtcgagcagttaggccgcgagcgactgcggcgccgagccgatgagtaacccgaagcccctagaggagtggtcacctgcctgagggcacttctgtcccaccagcatcagaccaggccgcaccgagtccccggcaccatgtttgggaagaggaagaagcgggtggagatctccgcgccgtccaacttcgagcaccgcgtgcacacgggcttcgaccagcacgagcagaagttcacggggctgccccgccagtggcagagcctgatcgaggagtcggctcgccggcccaagcccctcgtcgaccccgcctgcatcacctccatccagcccggggcccccaagggggagcctcatgacgtggcccctaacgggccatcagcggggggcctggccatcccccagtcctcctcctcctcctcccggcctcccacccgagcccgaggtgcccccagccctggagtgctgggaccccacgcctcagagccccagctggcccctccagcctgcacccccgccgcccctgctgttcctgggccccctggcccccgctcaccacagcgggagccacagcgagtatcccatgagcagttccgggctgccctgcagctggtggtggacccaggcgacccccgctcctacctggacaacttcatcaagattggcgagggctccacgggcatcgtgtgcatcgccaccgtgcgcagctcgggcaagctggtggccgtcaagaagatggacctgcgcaagcagcagaggcgcgagctgctcttcaacgaggtggtaatcatgagggactaccagcacgagaatgtggtggagatgtacaacagctacctggtgggggacgagctctgggtggtcatggagttcctggaaggaggcgccctcaccgacatcgtcacccacaccaggatgaacgaggagcagatcgcggccgtgtgccttgcagtgctgcaggccctgtcggtgctccacgcccagggcgtcatccaccgggacatcaagagcgactcgatcctgctgacccatgatggcagggtgaagctgtcagactttgggttctgcgcccaggtgagcaaggaagtgccccgaaggaagtcgctggtcggcacgccctactggatggccccagagctcatctcccgccttccctacgggccagaggtagacatctggtcgctggggataatggtgattgagatggtggacggagagcccccctacttcaacgagccacccctcaaagccatgaagatgattcgggacaacctgccaccccgactgaagaacctgcacaaggtgtcgccatccctgaagggcttcctggaccgcctgctggtgcgagaccctgcccagcgggccacggcagccgagctgctgaagcacccattcctggccaaggcagggccgcctgccagcatcgtgcccctcatgcgccagaaccgcaccagatgaggcccagcgcccttcccctcaaccaaagagccccccgggtcacccccgccccactgaggccagtagggggccaggcctcccactcctcccagcccgggagatgctccgcgtggcaccaccctccttgctgggggtagatgagaccctactactgaactccagttttgatctcgtgacttttagaaaaacacagggactcgtgggagcaagcgaggctcccaggacccccaccctctgggacaggccctcccccatgttcttctgtctccaggaagggcagcggccctcccatcactggaagtctgcagtgggggtcgctgggggtggagagaacactaagaggtgaacatgtatgagtgtgtgcacgcgtgtgagtgtgcatgtgtgtgtgtgcaaaggtccagccaccccgtcctccagcctgcaaggggtgtctggcgccttgcctgacacccagccccctctccccctgagccattgtgggggtcgatcatgaatgtccgaagagtggccttttcccgtagccctgcgccccctttctgtggctggatggggagacaggtcagggccccccaccctctccagcccctgcagcaaatgactactgcacctggacagcctcctcttttctagaagtctatttatattgtcattttataacactctagcccctgcccttattgggggacagatggtccctgtcctgcggggtggccctggcagaaccactgcctgaagaaccaggttcctgcccggtcagcgcagccccagcccgcccacccctgcctcgagttagttttacaattaaaacattgtcttgttttgtg
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10298 -> Molecular function: GO:0004672 [protein kinase activity] evidence: NAS
GeneID:10298 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IEA
GeneID:10298 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:10298 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:10298 -> Biological process: GO:0006928 [cellular component movement] evidence: TAS
GeneID:10298 -> Biological process: GO:0007010 [cytoskeleton organization] evidence: TAS
GeneID:10298 -> Biological process: GO:0007049 [cell cycle] evidence: IEA
GeneID:10298 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:10298 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS
GeneID:10298 -> Biological process: GO:0016049 [cell growth] evidence: TAS
GeneID:10298 -> Biological process: GO:0016477 [cell migration] evidence: TAS
GeneID:10298 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001014835 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.