Home |
Help |
Advanced search
2024-04-20 23:27:17, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001014834 2306 bp mRNA linear PRI 02-JUN-2013
DEFINITION Homo sapiens p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4),
transcript variant 5, mRNA.
ACCESSION NM_001014834
VERSION NM_001014834.2 GI:126273532
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2306)
AUTHORS Kim,S.H., Kim,S.R., Ihm,H.J., Oh,Y.S., Chae,H.D., Kim,C.H. and
Kang,B.M.
TITLE Regulation of P21-activated kinase-4 by progesterone and tumor
necrosis factor-alpha in human endometrium and its increased
expression in advanced-stage endometriosis
JOURNAL J. Clin. Endocrinol. Metab. 98 (2), E238-E248 (2013)
PUBMED 23293332
REMARK GeneRIF: increased expression of Pak4 might lead to the
establishment and progression of endometriosis by enhanced cellular
viability and invasiveness in endometrial cells.
REFERENCE 2 (bases 1 to 2306)
AUTHORS Wang,Z., Zhang,X., Yang,Z., Du,H., Wu,Z., Gong,J., Yan,J. and
Zheng,Q.
TITLE MiR-145 regulates PAK4 via the MAPK pathway and exhibits an
antitumor effect in human colon cells
JOURNAL Biochem. Biophys. Res. Commun. 427 (3), 444-449 (2012)
PUBMED 22766504
REMARK GeneRIF: these findings demonstrate that miR-145 downregulates
P-ERK expression by targeting PAK4 and leads to inhibition of tumor
growth.
REFERENCE 3 (bases 1 to 2306)
AUTHORS Ha,B.H., Davis,M.J., Chen,C., Lou,H.J., Gao,J., Zhang,R.,
Krauthammer,M., Halaban,R., Schlessinger,J., Turk,B.E. and
Boggon,T.J.
TITLE Type II p21-activated kinases (PAKs) are regulated by an
autoinhibitory pseudosubstrate
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 109 (40), 16107-16112 (2012)
PUBMED 22988085
REMARK GeneRIF: Full-length PAK4 is constitutively autoinibited, but
mutation of the pseudosubstrate releases this inhibition.
REFERENCE 4 (bases 1 to 2306)
AUTHORS Baskaran,Y., Ng,Y.W., Selamat,W., Ling,F.T. and Manser,E.
TITLE Group I and II mammalian PAKs have different modes of activation by
Cdc42
JOURNAL EMBO Rep. 13 (7), 653-659 (2012)
PUBMED 22653441
REMARK GeneRIF: PAK4 is strongly inhibited by an auto-inhibitory domain
formed by amino acids 20 to 68.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 2306)
AUTHORS Kesanakurti,D., Chetty,C., Rajasekhar Maddirela,D., Gujrati,M. and
Rao,J.S.
TITLE Functional cooperativity by direct interaction between PAK4 and
MMP-2 in the regulation of anoikis resistance, migration and
invasion in glioma
JOURNAL Cell Death Dis 3, E445 (2012)
PUBMED 23254288
REMARK GeneRIF: Interaction between PAK4 and MMP-2 regulated anoikis, cell
migration and invasion in glioma.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 2306)
AUTHORS Lu,Y., Pan,Z.Z., Devaux,Y. and Ray,P.
TITLE p21-activated protein kinase 4 (PAK4) interacts with the
keratinocyte growth factor receptor and participates in
keratinocyte growth factor-mediated inhibition of oxidant-induced
cell death
JOURNAL J. Biol. Chem. 278 (12), 10374-10380 (2003)
PUBMED 12529371
REMARK GeneRIF: PAK4 interacts with KGF receptor and mediate
anti-apoptosis effects of KGF on epithelial cells.
REFERENCE 7 (bases 1 to 2306)
AUTHORS Zhang,H., Li,Z., Viklund,E.K. and Stromblad,S.
TITLE P21-activated kinase 4 interacts with integrin alpha v beta 5 and
regulates alpha v beta 5-mediated cell migration
JOURNAL J. Cell Biol. 158 (7), 1287-1297 (2002)
PUBMED 12356872
REFERENCE 8 (bases 1 to 2306)
AUTHORS Dan,C., Kelly,A., Bernard,O. and Minden,A.
TITLE Cytoskeletal changes regulated by the PAK4 serine/threonine kinase
are mediated by LIM kinase 1 and cofilin
JOURNAL J. Biol. Chem. 276 (34), 32115-32121 (2001)
PUBMED 11413130
REFERENCE 9 (bases 1 to 2306)
AUTHORS Bagrodia,S. and Cerione,R.A.
TITLE Pak to the future
JOURNAL Trends Cell Biol. 9 (9), 350-355 (1999)
PUBMED 10461188
REMARK Review article
REFERENCE 10 (bases 1 to 2306)
AUTHORS Abo,A., Qu,J., Cammarano,M.S., Dan,C., Fritsch,A., Baud,V.,
Belisle,B. and Minden,A.
TITLE PAK4, a novel effector for Cdc42Hs, is implicated in the
reorganization of the actin cytoskeleton and in the formation of
filopodia
JOURNAL EMBO J. 17 (22), 6527-6540 (1998)
PUBMED 9822598
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BG773480.1, AL834236.1 and
AB032968.1.
On Feb 27, 2007 this sequence version replaced gi:62422560.
Summary: PAK proteins, a family of serine/threonine p21-activating
kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are
critical effectors that link Rho GTPases to cytoskeleton
reorganization and nuclear signaling. They serve as targets for the
small GTP binding proteins Cdc42 and Rac and have been implicated
in a wide range of biological activities. PAK4 interacts
specifically with the GTP-bound form of Cdc42Hs and weakly
activates the JNK family of MAP kinases. PAK4 is a mediator of
filopodia formation and may play a role in the reorganization of
the actin cytoskeleton. Multiple alternatively spliced transcript
variants encoding distinct isoforms have been found for this gene.
[provided by RefSeq, Jul 2008].
Transcript Variant: This variant (5) lacks an exon in the 5' UTR
and an in-frame exon in the coding region, as compared to variant
1. The encoded isoform (2) thus lacks an internal segment, as
compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AL834236.1, AK294586.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-27 BG773480.1 26-52
28-2304 AL834236.1 2-2278
2305-2306 AB032968.1 2324-2325
FEATURES Location/Qualifiers
source 1..2306
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.2"
gene 1..2306
/gene="PAK4"
/note="p21 protein (Cdc42/Rac)-activated kinase 4"
/db_xref="GeneID:10298"
/db_xref="HGNC:16059"
/db_xref="MIM:605451"
exon 1..140
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 56
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:71356837"
variation 74
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:4803205"
variation 102
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:4803206"
variation 116
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:111999288"
exon 141..366
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 143
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376621337"
variation 144
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:370008929"
variation 148
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:690929"
variation 149
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:201511246"
variation 151
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:149068416"
variation 156
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:373760840"
variation 157
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:376606539"
CDS 163..1479
/gene="PAK4"
/EC_number="2.7.11.1"
/note="isoform 2 is encoded by transcript variant 5;
protein kinase related to S. cerevisiae STE20, effector
for Cdc42Hs; p21(CDKN1A)-activated kinase 4;
serine/threonine-protein kinase PAK 4; PAK-4;
p21-activated kinase 4"
/codon_start=1
/product="serine/threonine-protein kinase PAK 4 isoform 2"
/protein_id="NP_001014834.1"
/db_xref="GI:62422561"
/db_xref="CCDS:CCDS33019.1"
/db_xref="GeneID:10298"
/db_xref="HGNC:16059"
/db_xref="MIM:605451"
/translation="
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACITSIQPGAPKGEPHDVAPNGPSAGGLAIPQSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
"
misc_feature 190..306
/gene="PAK4"
/note="PAK (p21 activated kinase) Binding Domain (PBD),
binds Cdc42p- and/or Rho-like small GTPases; also known as
the Cdc42/Rac interactive binding (CRIB) motif; has been
shown to inhibit transcriptional activation and cell
transformation mediated by the...; Region: CRIB_PAK_like;
cd01093"
/db_xref="CDD:29038"
misc_feature order(193..195,202..204,211..213,217..219,226..228,
277..279,289..291)
/gene="PAK4"
/note="GTPase interaction site [polypeptide binding];
other site"
/db_xref="CDD:29038"
misc_feature 283..285
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O96013.1); phosphorylation site"
misc_feature 475..477
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:05675"
misc_feature 574..576
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:05675"
misc_feature 604..1458
/gene="PAK4"
/note="Catalytic domain of the Protein Serine/Threonine
Kinase, Group II p21-activated kinase; Region:
STKc_PAK_II; cd06648"
/db_xref="CDD:132979"
misc_feature 679..1419
/gene="PAK4"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(682..696,706..708,745..747,751..753,778..780,
838..840,886..900,904..909,916..918,1021..1023,1027..1038,
1042..1044,1072..1077,1084..1086,1123..1137,1141..1143,
1222..1224,1249..1257)
/gene="PAK4"
/note="active site"
/db_xref="CDD:132979"
misc_feature order(682..696,706..708,745..747,751..753,838..840,
886..900,904..909,916..918,1033..1038,1042..1044,
1072..1077)
/gene="PAK4"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:132979"
misc_feature order(691..696,778..780,1021..1023,1027..1035,1084..1086,
1123..1137,1141..1143,1222..1224,1249..1257)
/gene="PAK4"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:132979"
misc_feature 1072..1143
/gene="PAK4"
/note="activation loop (A-loop); other site"
/db_xref="CDD:132979"
misc_feature 1123..1125
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 1135..1137
/gene="PAK4"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:05675"
variation 198
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:370966374"
variation 200
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:146498509"
variation 204
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:141017388"
variation 207
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:200199299"
variation 209
/gene="PAK4"
/replace=""
/replace="a"
/db_xref="dbSNP:66579155"
variation 210
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:199730416"
variation 222
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:114564484"
variation 223
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:146583353"
variation 231
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:199597836"
variation 237
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:113813881"
variation 246
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:75096376"
variation 291
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:373656030"
variation 292
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:200500244"
variation 321
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:377525201"
variation 322
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:148292608"
variation 326
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:112229040"
variation 336
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:200638581"
variation 354
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:141602417"
variation 357
/gene="PAK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:371051871"
variation 358
/gene="PAK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:373324891"
variation 359
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376845802"
exon 367..801
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 367
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:370852872"
variation 371
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:371684690"
variation 372
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:138516359"
variation 373
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375872670"
variation 382
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:200391013"
variation 410
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:368557621"
variation 415
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:371973365"
variation 446
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:199929260"
variation 471
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375137743"
variation 477
/gene="PAK4"
/replace=""
/replace="c"
/db_xref="dbSNP:35120836"
variation 523
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:200534045"
variation 538
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:369318453"
variation 540
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:190702581"
variation 571
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375957288"
STS 597..893
/gene="PAK4"
/standard_name="MARC_20651-20652:1024691026:1"
/db_xref="UniSTS:268460"
variation 642
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:369018322"
variation 649
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:143998317"
variation 651
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201587224"
variation 656
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:147291859"
variation 684
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:374237195"
variation 687
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:371904272"
variation 717
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:370908993"
variation 721
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:140420249"
variation 731
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:149267288"
variation 732
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:144457438"
variation 747
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:148400225"
exon 802..935
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 829
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:375220515"
variation 852
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:146831773"
variation 857
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:142488595"
variation 870
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:368459616"
variation 912
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:56306494"
variation 918
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559035"
variation 920
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:146517848"
variation 921
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:372653621"
exon 936..1062
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 942
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376504839"
variation 960
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:139956496"
variation 961
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:370017586"
variation 981
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:374443098"
variation 989
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:377696830"
variation 990
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:116665223"
variation 999
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:371674508"
variation 1018
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375117492"
variation 1026
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:146720735"
variation 1029
/gene="PAK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:11559036"
variation 1032
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:141004307"
exon 1063..1188
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 1069
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559033"
variation 1115
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:373414547"
variation 1125
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:56286946"
variation 1126
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559034"
variation 1131
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201757969"
variation 1164
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:200775475"
variation 1169
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:147024501"
variation 1174
/gene="PAK4"
/replace=""
/replace="c"
/db_xref="dbSNP:34054211"
variation 1176
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:138564503"
variation 1179
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:144059751"
exon 1189..1323
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 1203
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:151137853"
variation 1207
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:193920877"
variation 1234
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:141267072"
variation 1244
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:368539931"
variation 1245
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:146955542"
variation 1254
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:375810830"
variation 1255
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:372098486"
variation 1275
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:111768373"
variation 1281
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:11559037"
variation 1305
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:201791285"
exon 1324..2306
/gene="PAK4"
/inference="alignment:Splign:1.39.8"
variation 1355
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:200026990"
variation 1365
/gene="PAK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:34569811"
variation 1366
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:56084716"
variation 1389
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:55747949"
variation 1396
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:150747591"
variation 1420
/gene="PAK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:149210444"
variation 1487
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:371711789"
variation 1515
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:376520116"
variation 1575
/gene="PAK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:113335516"
variation 1588
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:186511166"
variation 1651
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:377438234"
variation 1652
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:143251867"
variation 1732
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:3752161"
variation 1760
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:79890280"
variation 1761
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:45573536"
variation 1775
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:374106536"
variation 1860..1861
/gene="PAK4"
/replace=""
/replace="tg"
/db_xref="dbSNP:3833875"
variation 1861..1862
/gene="PAK4"
/replace=""
/replace="tg"
/db_xref="dbSNP:373786885"
variation 1862..1863
/gene="PAK4"
/replace=""
/replace="gt"
/db_xref="dbSNP:142481159"
variation 1873..1874
/gene="PAK4"
/replace=""
/replace="tg"
/db_xref="dbSNP:67439622"
variation 1902
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:13228"
variation 1925
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:114113304"
variation 1953..1954
/gene="PAK4"
/replace=""
/replace="c"
/db_xref="dbSNP:34766623"
variation 1998
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559032"
variation 2016..2017
/gene="PAK4"
/replace=""
/replace="tt"
/db_xref="dbSNP:377017717"
variation 2048
/gene="PAK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:114754037"
variation 2109
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:11559031"
STS 2151..2277
/gene="PAK4"
/standard_name="RH12716"
/db_xref="UniSTS:3224"
variation 2240
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:73933820"
variation 2247
/gene="PAK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:11122"
variation 2251
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:45472902"
variation 2268
/gene="PAK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:370782442"
polyA_signal 2283..2288
/gene="PAK4"
variation 2291
/gene="PAK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:181552710"
polyA_site 2306
/gene="PAK4"
ORIGIN
agccccggatgttcgttggggattcaacatggcggcgggagtgtccgcggtggtggcggtgcaagagagctgagggaggcgcgagggcgcggagttccaggtcgagcagttaggccgcgagcgactgcggcgccgagccggccgcaccgagtccccggcaccatgtttgggaagaggaagaagcgggtggagatctccgcgccgtccaacttcgagcaccgcgtgcacacgggcttcgaccagcacgagcagaagttcacggggctgccccgccagtggcagagcctgatcgaggagtcggctcgccggcccaagcccctcgtcgaccccgcctgcatcacctccatccagcccggggcccccaagggggagcctcatgacgtggcccctaacgggccatcagcggggggcctggccatcccccagtcctcctcctcctcctcccggcctcccacccgagcccgaggtgcccccagccctggagtgctgggaccccacgcctcagagccccagctggcccctccagcctgcacccccgccgcccctgctgttcctgggccccctggcccccgctcaccacagcgggagccacagcgagtatcccatgagcagttccgggctgccctgcagctggtggtggacccaggcgacccccgctcctacctggacaacttcatcaagattggcgagggctccacgggcatcgtgtgcatcgccaccgtgcgcagctcgggcaagctggtggccgtcaagaagatggacctgcgcaagcagcagaggcgcgagctgctcttcaacgaggtggtaatcatgagggactaccagcacgagaatgtggtggagatgtacaacagctacctggtgggggacgagctctgggtggtcatggagttcctggaaggaggcgccctcaccgacatcgtcacccacaccaggatgaacgaggagcagatcgcggccgtgtgccttgcagtgctgcaggccctgtcggtgctccacgcccagggcgtcatccaccgggacatcaagagcgactcgatcctgctgacccatgatggcagggtgaagctgtcagactttgggttctgcgcccaggtgagcaaggaagtgccccgaaggaagtcgctggtcggcacgccctactggatggccccagagctcatctcccgccttccctacgggccagaggtagacatctggtcgctggggataatggtgattgagatggtggacggagagcccccctacttcaacgagccacccctcaaagccatgaagatgattcgggacaacctgccaccccgactgaagaacctgcacaaggtgtcgccatccctgaagggcttcctggaccgcctgctggtgcgagaccctgcccagcgggccacggcagccgagctgctgaagcacccattcctggccaaggcagggccgcctgccagcatcgtgcccctcatgcgccagaaccgcaccagatgaggcccagcgcccttcccctcaaccaaagagccccccgggtcacccccgccccactgaggccagtagggggccaggcctcccactcctcccagcccgggagatgctccgcgtggcaccaccctccttgctgggggtagatgagaccctactactgaactccagttttgatctcgtgacttttagaaaaacacagggactcgtgggagcaagcgaggctcccaggacccccaccctctgggacaggccctcccccatgttcttctgtctccaggaagggcagcggccctcccatcactggaagtctgcagtgggggtcgctgggggtggagagaacactaagaggtgaacatgtatgagtgtgtgcacgcgtgtgagtgtgcatgtgtgtgtgtgcaaaggtccagccaccccgtcctccagcctgcaaggggtgtctggcgccttgcctgacacccagccccctctccccctgagccattgtgggggtcgatcatgaatgtccgaagagtggccttttcccgtagccctgcgccccctttctgtggctggatggggagacaggtcagggccccccaccctctccagcccctgcagcaaatgactactgcacctggacagcctcctcttttctagaagtctatttatattgtcattttataacactctagcccctgcccttattgggggacagatggtccctgtcctgcggggtggccctggcagaaccactgcctgaagaaccaggttcctgcccggtcagcgcagccccagcccgcccacccctgcctcgagttagttttacaattaaaacattgtcttgttttgtg
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10298 -> Molecular function: GO:0004672 [protein kinase activity] evidence: NAS
GeneID:10298 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IEA
GeneID:10298 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:10298 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:10298 -> Biological process: GO:0006928 [cellular component movement] evidence: TAS
GeneID:10298 -> Biological process: GO:0007010 [cytoskeleton organization] evidence: TAS
GeneID:10298 -> Biological process: GO:0007049 [cell cycle] evidence: IEA
GeneID:10298 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:10298 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS
GeneID:10298 -> Biological process: GO:0016049 [cell growth] evidence: TAS
GeneID:10298 -> Biological process: GO:0016477 [cell migration] evidence: TAS
GeneID:10298 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001014834 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.