GGRNA Home | Help | Advanced search

2025-07-09 15:22:36, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001012513             844 bp    mRNA    linear   PRI 30-MAY-2013
DEFINITION  Homo sapiens gastrin-releasing peptide (GRP), transcript variant 3,
            mRNA.
ACCESSION   NM_001012513
VERSION     NM_001012513.1  GI:60498998
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 844)
  AUTHORS   Nordlund,M.S., Stieber,P., Brustugun,O.T., Warren,D.J. and Paus,E.
  TITLE     Characteristics and clinical validity of two immunoassays for
            ProGRP
  JOURNAL   Tumour Biol. 33 (4), 1105-1113 (2012)
   PUBMED   22399443
  REMARK    GeneRIF: Data indicate that progastrin-releasing peptide (proGRP)
            assays with both time-resolved immunofluorometric assay (TR-IFMA)
            and Advanced Life Science Institute (ALSI) ELISA showed good
            clinical validity.
REFERENCE   2  (bases 1 to 844)
  AUTHORS   Ono,A., Naito,T., Ito,I., Watanabe,R., Shukuya,T., Kenmotsu,H.,
            Tsuya,A., Nakamura,Y., Murakami,H., Kaira,K., Takahashi,T.,
            Kameya,T., Nakajima,T., Endo,M. and Yamamoto,N.
  TITLE     Correlations between serial pro-gastrin-releasing peptide and
            neuron-specific enolase levels, and the radiological response to
            treatment and survival of patients with small-cell lung cancer
  JOURNAL   Lung Cancer 76 (3), 439-444 (2012)
   PUBMED   22300752
  REMARK    GeneRIF: Percent changes in serum ProGRP showed better correlation
            to the sum of the tumor diameters (SOD) and prognostic impact than
            that of NSE.
REFERENCE   3  (bases 1 to 844)
  AUTHORS   Tattersall,M., Cordeaux,Y., Charnock-Jones,D.S. and Smith,G.C.
  TITLE     Expression of gastrin-releasing peptide is increased by prolonged
            stretch of human myometrium, and antagonists of its receptor
            inhibit contractility
  JOURNAL   J. Physiol. (Lond.) 590 (PT 9), 2081-2093 (2012)
   PUBMED   22411014
  REMARK    GeneRIF: Tonic stretch of human myometrium increases contractility
            and stimulates the expression of a known smooth muscle stimulatory
            agonist, GRP. GRP receptor antagonists attenuate the effect of
            stretch.
REFERENCE   4  (bases 1 to 844)
  AUTHORS   Patel,O., Clyde,D., Chang,M., Nordlund,M.S., Steel,R., Kemp,B.E.,
            Pritchard,D.M., Shulkes,A. and Baldwin,G.S.
  TITLE     Pro-GRP-derived peptides are expressed in colorectal cancer cells
            and tumors and are biologically active in vivo
  JOURNAL   Endocrinology 153 (3), 1082-1092 (2012)
   PUBMED   22202166
  REMARK    GeneRIF: nonamidated peptides derived from the C terminus of
            pro-GRP are expressed in significant quantities in colorectal
            cancer cell lines
REFERENCE   5  (bases 1 to 844)
  AUTHORS   Kim,S.Y., Kim,J.S., Hwang,S.H., Park,H.K., Lee,J.H., Lee,D.H.,
            Hah,S.S. and Park do,Y.
  TITLE     Progastrin-releasing peptide is a candidate marker for quality
            control in clinical sample processing and storage
  JOURNAL   Am. J. Clin. Pathol. 137 (2), 277-282 (2012)
   PUBMED   22261454
  REMARK    GeneRIF: Progastrin-releasing peptide cab be used as a marker for
            quality control in clinical sample processing and storage.
REFERENCE   6  (bases 1 to 844)
  AUTHORS   Baraniuk,J.N., Lundgren,J.D., Shelhamer,J.H. and Kaliner,M.A.
  TITLE     Gastrin releasing peptide (GRP) binding sites in human bronchi
  JOURNAL   Neuropeptides 21 (2), 81-84 (1992)
   PUBMED   1557184
REFERENCE   7  (bases 1 to 844)
  AUTHORS   Naylor,S.L., Sakaguchi,A.Y., Spindel,E. and Chin,W.W.
  TITLE     Human gastrin-releasing peptide gene is located on chromosome 18
  JOURNAL   Somat. Cell Mol. Genet. 13 (1), 87-91 (1987)
   PUBMED   3027902
REFERENCE   8  (bases 1 to 844)
  AUTHORS   Lebacq-Verheyden,A.M., Bertness,V., Kirsch,I., Hollis,G.F.,
            McBride,O.W. and Battey,J.
  TITLE     Human gastrin-releasing peptide gene maps to chromosome band 18q21
  JOURNAL   Somat. Cell Mol. Genet. 13 (1), 81-86 (1987)
   PUBMED   3027901
REFERENCE   9  (bases 1 to 844)
  AUTHORS   Sausville,E.A., Lebacq-Verheyden,A.M., Spindel,E.R., Cuttitta,F.,
            Gazdar,A.F. and Battey,J.F.
  TITLE     Expression of the gastrin-releasing peptide gene in human small
            cell lung cancer. Evidence for alternative processing resulting in
            three distinct mRNAs
  JOURNAL   J. Biol. Chem. 261 (5), 2451-2457 (1986)
   PUBMED   3003116
REFERENCE   10 (bases 1 to 844)
  AUTHORS   Spindel,E.R., Zilberberg,M.D., Habener,J.F. and Chin,W.W.
  TITLE     Two prohormones for gastrin-releasing peptide are encoded by two
            mRNAs differing by 19 nucleotides
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 83 (1), 19-23 (1986)
   PUBMED   3001723
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC004488.2 and CK903483.1.
            
            Summary: This gene encodes a member of the bombesin-like family of
            gastrin-releasing peptides. Its preproprotein, following cleavage
            of a signal peptide, is further processed to produce either the 27
            aa gastrin-releasing peptide or the 10 aa neuromedin C. These
            smaller peptides regulate numerous functions of the
            gastrointestinal and central nervous systems, including release of
            gastrointestinal hormones, smooth muscle cell contraction, and
            epithelial cell proliferation. These peptides are also likely to
            play a role in human cancers of the lung, colon, stomach, pancreas,
            breast, and prostate. Alternative splicing results in multiple
            transcript variants encoding different isoforms. [provided by
            RefSeq, Jul 2008].
            
            Transcript Variant: This variant (3) uses an alternate splice site
            in the coding region, which results in a frameshift and an early
            stop codon, compared to variant 1. It encodes isoform 3 which has a
            shorter and distinct C-terminus, compared to isoform 1. This
            variant has also been identified as 'splice isoform 2',
            'pro-gastrin releasing peptide type 3', and 'gastrin-releasing
            peptide nirs variant 1'.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CK903483.1, BI964898.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-237               BC004488.2         1-237
            238-461             CK903483.1         234-457
            462-844             BC004488.2         481-863
FEATURES             Location/Qualifiers
     source          1..844
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="18"
                     /map="18q21.1-q21.32"
     gene            1..844
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /note="gastrin-releasing peptide"
                     /db_xref="GeneID:2922"
                     /db_xref="HGNC:4605"
                     /db_xref="MIM:137260"
     exon            1..237
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /inference="alignment:Splign:1.39.8"
     CDS             99..515
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /note="isoform 3 preproprotein is encoded by transcript
                     variant 3; bombesin; neuromedin C; pre-progastrin
                     releasing peptide; prepro-GRP"
                     /codon_start=1
                     /product="gastrin-releasing peptide isoform 3
                     preproprotein"
                     /protein_id="NP_001012531.1"
                     /db_xref="GI:60498999"
                     /db_xref="CCDS:CCDS45878.1"
                     /db_xref="GeneID:2922"
                     /db_xref="HGNC:4605"
                     /db_xref="MIM:137260"
                     /translation="
MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDLVDSLLQVLNVKEGTPS
"
     sig_peptide     99..167
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     proprotein      168..512
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /product="gastrin-releasing peptide proprotein"
     mat_peptide     168..248
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /product="gastrin-releasing peptide"
     misc_feature    207..209
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02667"
     misc_feature    213..215
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02667"
     misc_feature    216..218
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02667"
     misc_feature    219..260
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /note="Bombesin-like peptide; Region: Bombesin; pfam02044"
                     /db_xref="CDD:110990"
     mat_peptide     219..248
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /product="neuromedin C"
                     /exception="alternative processing"
     misc_feature    222..224
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     misc_feature    225..227
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     misc_feature    228..230
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     misc_feature    231..233
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     misc_feature    240..242
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     misc_feature    246..248
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Methionine amide; propagated from
                     UniProtKB/Swiss-Prot (P07492.2); amidation site"
     variation       108
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1062557"
     variation       116
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372288358"
     variation       132
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35957920"
     variation       149
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042431"
     exon            238..461
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /inference="alignment:Splign:1.39.8"
     variation       242
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199962860"
     variation       247
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368410424"
     variation       261
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375754489"
     variation       278
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146673900"
     variation       289
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143274265"
     variation       318
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374866055"
     variation       338
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377146993"
     variation       361
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368021851"
     variation       370
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371397932"
     variation       407
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375963114"
     variation       423
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148328512"
     variation       427
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200302824"
     variation       428
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:55796466"
     variation       461
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:15526"
     exon            462..829
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /inference="alignment:Splign:1.39.8"
     variation       466
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200574825"
     variation       494..497
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace=""
                     /replace="gaag"
                     /db_xref="dbSNP:149962068"
     variation       496
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185933795"
     variation       535
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376342645"
     STS             538..812
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /standard_name="D18S1265"
                     /db_xref="UniSTS:68109"
     STS             560..804
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /standard_name="STS-K02054"
                     /db_xref="UniSTS:9077"
     variation       564
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369600106"
     variation       597
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2742"
     variation       743
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144426024"
     variation       750
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1803673"
     variation       801
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3180482"
     polyA_signal    803..808
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
     variation       820
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:72956189"
     polyA_site      829
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
ORIGIN      
ccagcggctgcggcggcggagctcctccgaggtccgggtcaccagtctctgctcttcccagcctctccggcgcgctccaagggcttcccgtcgggaccatgcgcggccgtgagctcccgctggtcctgctggcgctggtcctctgcctggcgccccgggggcgagcggtcccgctgcctgcgggcggagggaccgtgctgaccaagatgtacccgcgcggcaaccactgggcggtggggcacttaatggggaaaaagagcacaggggagtcttcttctgtttctgagagagggagcctgaagcagcagctgagagagtacatcaggtgggaagaagctgcaaggaatttgctgggtctcatagaagcaaaggagaacagaaaccaccagccacctcaacccaaggccctgggcaatcagcagccttcgtgggattcagaggatagcagcaacttcaaagatttggtagactctctgctccaggttctcaacgtgaaggaaggaacccccagctgaaccagcaatgataatgatggcctctctcaaaagagaaaaacaaaacccctaagagactgcgttctgcaagcatcagttctacggatcatcaacaagatttccttgtgcaaaatatttgactattctgtatctttcatccttgactaaattcgtgattttcaagcagcatcttctggtttaaacttgtttgctgtgaacaattgtcgaaaagagtcttccaattaatgcttttttatatctaggctacctgttggttagattcaaggccccgagctgttaccattcacaataaaagcttaaacacattgtccaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:2922 -> Molecular function: GO:0005102 [receptor binding] evidence: NAS
            GeneID:2922 -> Molecular function: GO:0005184 [neuropeptide hormone activity] evidence: IDA
            GeneID:2922 -> Biological process: GO:0007165 [signal transduction] evidence: NAS
            GeneID:2922 -> Biological process: GO:0007218 [neuropeptide signaling pathway] evidence: IDA
            GeneID:2922 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
            GeneID:2922 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.