GGRNA Home | Help | Advanced search

2024-04-19 13:15:46, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001012412            1599 bp    mRNA    linear   PRI 14-APR-2013
DEFINITION  Homo sapiens shugoshin-like 1 (S. pombe) (SGOL1), transcript
            variant B2, mRNA.
ACCESSION   NM_001012412
VERSION     NM_001012412.3  GI:312922396
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1599)
  AUTHORS   Greenwood,T.A., Akiskal,H.S., Akiskal,K.K. and Kelsoe,J.R.
  CONSRTM   Bipolar Genome Study
  TITLE     Genome-wide association study of temperament in bipolar disorder
            reveals significant associations with three novel Loci
  JOURNAL   Biol. Psychiatry 72 (4), 303-310 (2012)
   PUBMED   22365631
REFERENCE   2  (bases 1 to 1599)
  AUTHORS   Liu,L., Zhang,N., Liu,J., Min,J., Ma,N., Liu,N., Liu,Y. and
            Zhang,H.
  TITLE     Lentivirus-mediated siRNA interference targeting SGO-1 inhibits
            human NSCLC cell growth
  JOURNAL   Tumour Biol. 33 (2), 515-521 (2012)
   PUBMED   22161216
  REMARK    GeneRIF: Lentivirus-mediated siRNA interference targeting SGO-1
            inhibits human NSCLC cell growth
REFERENCE   3  (bases 1 to 1599)
  AUTHORS   Kahyo,T., Iwaizumi,M., Shinmura,K., Matsuura,S., Nakamura,T.,
            Watanabe,Y., Yamada,H. and Sugimura,H.
  TITLE     A novel tumor-derived SGOL1 variant causes abnormal mitosis and
            unstable chromatid cohesion
  JOURNAL   Oncogene 30 (44), 4453-4463 (2011)
   PUBMED   21532624
  REMARK    GeneRIF: These results suggest that SGOL1-P1 may function as a
            negative factor to native SGOL1, and that abundant expression of
            SGOL1-P1 may be responsible for chromosomal instability.
REFERENCE   4  (bases 1 to 1599)
  AUTHORS   Kang,J., Chaudhary,J., Dong,H., Kim,S., Brautigam,C.A. and Yu,H.
  TITLE     Mitotic centromeric targeting of HP1 and its binding to Sgo1 are
            dispensable for sister-chromatid cohesion in human cells
  JOURNAL   Mol. Biol. Cell 22 (8), 1181-1190 (2011)
   PUBMED   21346195
  REMARK    GeneRIF: HP1alpha binding by INCENP or Shugoshin 1 (Sgo1) is
            dispensable for centromeric cohesion protection during mitosis of
            human cells, but might regulate yet unknown interphase functions of
            the chromosome passenger complex (CPC) or Sgo1 at the centromeres.
REFERENCE   5  (bases 1 to 1599)
  AUTHORS   Okamoto,N., Kuwahara,K., Ohta,K., Kitabatake,M., Takagi,K.,
            Mizuta,H., Kondo,E. and Sakaguchi,N.
  TITLE     Germinal center-associated nuclear protein (GANP) is involved in
            mRNA export of Shugoshin-1 required for centromere cohesion and in
            sister-chromatid exchange
  JOURNAL   Genes Cells 15 (5), 471-484 (2010)
   PUBMED   20384790
  REMARK    GeneRIF: Data show that human germinal center-associated nuclear
            protein (GANP) is critically involved in cell proliferation at the
            mitotic phase through its selective support of shugoshin-1 mRNA
            export.
REFERENCE   6  (bases 1 to 1599)
  AUTHORS   Wang,X. and Dai,W.
  TITLE     Shugoshin, a guardian for sister chromatid segregation
  JOURNAL   Exp. Cell Res. 310 (1), 1-9 (2005)
   PUBMED   16112668
  REMARK    GeneRIF: A comprehensive review of Sgo1 function in eukaryote at
            meiosis and mitosis.
            Review article
REFERENCE   7  (bases 1 to 1599)
  AUTHORS   McGuinness,B.E., Hirota,T., Kudo,N.R., Peters,J.M. and Nasmyth,K.
  TITLE     Shugoshin prevents dissociation of cohesin from centromeres during
            mitosis in vertebrate cells
  JOURNAL   PLoS Biol. 3 (3), E86 (2005)
   PUBMED   15737064
  REMARK    GeneRIF: A shugoshin-like protein associates with centromeres
            during prophase and disappears at the onset of anaphase
REFERENCE   8  (bases 1 to 1599)
  AUTHORS   Kitajima,T.S., Hauf,S., Ohsugi,M., Yamamoto,T. and Watanabe,Y.
  TITLE     Human Bub1 defines the persistent cohesion site along the mitotic
            chromosome by affecting Shugoshin localization
  JOURNAL   Curr. Biol. 15 (4), 353-359 (2005)
   PUBMED   15723797
REFERENCE   9  (bases 1 to 1599)
  AUTHORS   Tang,Z., Sun,Y., Harley,S.E., Zou,H. and Yu,H.
  TITLE     Human Bub1 protects centromeric sister-chromatid cohesion through
            Shugoshin during mitosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (52), 18012-18017 (2004)
   PUBMED   15604152
  REMARK    GeneRIF: Bub1 protects centromeric cohesion through Shugoshin in
            mitosis
REFERENCE   10 (bases 1 to 1599)
  AUTHORS   Scanlan,M.J., Gout,I., Gordon,C.M., Williamson,B., Stockert,E.,
            Gure,A.O., Jager,D., Chen,Y.T., Mackay,A., O'Hare,M.J. and Old,L.J.
  TITLE     Humoral immunity to human breast cancer: antigen definition and
            quantitative analysis of mRNA expression
  JOURNAL   Cancer Immun. 1, 4 (2001)
   PUBMED   12747765
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BG530826.1, AB193058.1 and AB187580.1.
            On Nov 30, 2010 this sequence version replaced gi:142353902.
            
            Transcript Variant: This variant (B2) lacks an in-frame internal
            segment, as compared to variant A2. The resulting isoform (B2, also
            known as 1GH) lacks an internal segment, as compared to isoform A2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB187580.1, AB193063.1 [ECO:0000332]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-153               BG530826.1         2-154
            154-963             AB193058.1         75-884
            964-1599            AB187580.1         949-1584
FEATURES             Location/Qualifiers
     source          1..1599
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3p24.3"
     gene            1..1599
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /note="shugoshin-like 1 (S. pombe)"
                     /db_xref="GeneID:151648"
                     /db_xref="HGNC:25088"
                     /db_xref="HPRD:12377"
                     /db_xref="MIM:609168"
     exon            1..148
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(4)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145702873"
     variation       complement(36)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370108487"
     variation       complement(45)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375306760"
     variation       complement(53)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140520229"
     variation       complement(60)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151299371"
     misc_feature    138..140
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /note="upstream in-frame stop codon"
     exon            149..297
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /inference="alignment:Splign:1.39.8"
     CDS             156..1085
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /note="isoform B2 is encoded by transcript variant B2;
                     shugoshin 1AB protein; shugoshin 1CD protein; shugoshin
                     1EF protein; shugoshin 1GH protein; shugoshin 1KL protein;
                     hSgo1; serologically defined breast cancer antigen
                     NY-BR-85"
                     /codon_start=1
                     /product="shugoshin-like 1 isoform B2"
                     /protein_id="NP_001012412.1"
                     /db_xref="GI:60302873"
                     /db_xref="CCDS:CCDS46771.1"
                     /db_xref="GeneID:151648"
                     /db_xref="HGNC:25088"
                     /db_xref="HPRD:12377"
                     /db_xref="MIM:609168"
                     /translation="
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
"
     misc_feature    156..683
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5FBB7.1);
                     Region: Necessary for interaction with PPP2CA and PPP2R1A"
     misc_feature    195..197
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by NEK2; propagated from
                     UniProtKB/Swiss-Prot (Q5FBB7.1); phosphorylation site"
     misc_feature    219..356
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /note="Shugoshin N-terminal coiled-coil region; Region:
                     Shugoshin_N; pfam07558"
                     /db_xref="CDD:203682"
     misc_feature    810..887
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /note="Shugoshin C terminus; Region: Shugoshin_C;
                     pfam07557"
                     /db_xref="CDD:191783"
     variation       complement(185)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:143768051"
     variation       complement(217)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374022493"
     variation       complement(222)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199815268"
     variation       complement(246)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140691683"
     variation       complement(248)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202081733"
     variation       complement(254)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113892853"
     variation       complement(261)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377471833"
     variation       complement(269)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143576733"
     variation       complement(282)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145234403"
     variation       complement(291)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150552043"
     exon            298..494
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(316)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:192601368"
     variation       complement(329)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200787365"
     variation       complement(345)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189746950"
     variation       complement(393)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:145242036"
     variation       complement(397)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201174493"
     variation       complement(445)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202028804"
     variation       complement(467)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369840848"
     variation       complement(479)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375511922"
     variation       complement(489)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183736430"
     exon            495..571
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(520)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148317477"
     variation       complement(568)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147441982"
     exon            572..630
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /inference="alignment:Splign:1.39.8"
     exon            631..681
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(659)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:61729306"
     variation       complement(667)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6806241"
     exon            682..871
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(704)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368034531"
     variation       complement(717)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375090371"
     variation       complement(722)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199965073"
     variation       complement(729)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139053195"
     variation       complement(736)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139869512"
     variation       complement(754)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146108565"
     variation       complement(785)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:75326306"
     variation       complement(818)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113607987"
     variation       complement(842)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149344897"
     variation       complement(843)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372402306"
     variation       complement(859)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:181464459"
     exon            872..963
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(873)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:13060316"
     variation       complement(935)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200039832"
     variation       complement(952)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77194360"
     exon            964..1597
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(967)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199603756"
     variation       complement(972)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369926768"
     variation       complement(1018)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368430426"
     variation       complement(1031)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151004231"
     variation       complement(1036)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200770059"
     variation       complement(1044)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148485165"
     variation       complement(1045)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375535687"
     variation       complement(1066)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139865348"
     variation       complement(1085..1087)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace=""
                     /replace="aag"
                     /db_xref="dbSNP:147648109"
     variation       complement(1102)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368161123"
     variation       complement(1111..1112)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace=""
                     /replace="tt"
                     /db_xref="dbSNP:200745858"
     variation       complement(1129)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374709212"
     variation       complement(1130)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370945018"
     variation       complement(1158)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:191550560"
     variation       complement(1178)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185656328"
     variation       complement(1439)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140309229"
     variation       complement(1453)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138585609"
     variation       complement(1473)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182471636"
     variation       complement(1499)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:189655218"
     variation       complement(1570)
                     /gene="SGOL1"
                     /gene_synonym="NY-BR-85; SGO; Sgo1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150147188"
ORIGIN      
gaatgtggcggcggtagttccaggcgacggcggacggtggtacggtcctggagggcccagtgcgcggggctagccgtggctggagagcttcgaagagccttgaaatgtgaggaggaggaagatagctgttgcagaagtagtggccaaggcaaaagatggccaaggaaagatgcctgaaaaagtcctttcaagatagtcttgaagacataaagaagcgaatgaaagagaaaaggaataaaaacttggcagagattggcaaacgcaggtcttttatagctgcaccatgccaaataatcaccaacacttctacactgctgaaaaattaccaagacaacaacaaaatgttagttttagctttggaaaatgaaaaatccaaagtgaaagaagcccaagatatcatcctacagctgagaaaagaatgttactatctcacatgtcagctatatgcattgaaaggaaaacttacatcacaacaaacagtagaacctgctcagaaccaggaaatatgttcctctggaatggaccccaatagtgatgacagctccagaaatttatttgtgaaggatttaccgcaaattcctcttgaagaaactgaacttccaggacaaggagaatcatttcaaatagaagatcagatacctactattcctcaagacacactgggagttgattttgattcagctacaccacctgaaactcagcagtcacctcatcttagcctgaaggatatcaccaatgtctccttgtatcctgttgtgaaaatcagaagactttctctttctccaaaaaagaataaagcaagcccagcagtggctctgcctaaacgtaggtgcacagccagcgtgaactataaggagcccaccctcgcttcgaaactgagaagaggggacccttttacagatttgtgttttttgaattctcctattttcaagcagaaaaaggatttgagacgttctaaaaaaagagccctggaggtatcacctgccaaagaagcaatttttattttatattatgttcgagaatttgtttcgagattcccagactgtaggaaatgtaaacttgaaacccacatctgcttgaggtaaagtccacgggcttcacatccttagaaaacttttttagtccatgcattcactaatgtatgcagacctttaatagattctagctttatgtgttgggggagagatggaggggtgttgacagtctgtttcactcagcctacatacataataaaatctaagccctttaattagagatagcaactttcccagggtgaccgaggaatcagtacgtgttgaacccctcttttaagtttccttttggttgtgtcacttggagattgccttttctttcttgtaagctcagctgtgtcctcaaatatattgcattttacccagcatttccaggtgttttcaggggtcaaagtttttaagttatcttagtctttgatattgtgtaagcgaaattctccaatcccatctcctagatgatttttttttaaatcacaaaatgtgattatgcttaacagctgtttcctgtttctcttaaaataaaatccatttcctatttctcttaaaataaaatccattattcttaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:151648 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:151648 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
            GeneID:151648 -> Biological process: GO:0007059 [chromosome segregation] evidence: IDA
            GeneID:151648 -> Biological process: GO:0007067 [mitosis] evidence: IEA
            GeneID:151648 -> Biological process: GO:0008608 [attachment of spindle microtubules to kinetochore] evidence: IDA
            GeneID:151648 -> Biological process: GO:0010457 [centriole-centriole cohesion] evidence: IDA
            GeneID:151648 -> Biological process: GO:0045132 [meiotic chromosome segregation] evidence: IEA
            GeneID:151648 -> Biological process: GO:0051301 [cell division] evidence: IEA
            GeneID:151648 -> Cellular component: GO:0000775 [chromosome, centromeric region] evidence: IDA
            GeneID:151648 -> Cellular component: GO:0000776 [kinetochore] evidence: IDA
            GeneID:151648 -> Cellular component: GO:0000777 [condensed chromosome kinetochore] evidence: IEA
            GeneID:151648 -> Cellular component: GO:0000779 [condensed chromosome, centromeric region] evidence: IDA
            GeneID:151648 -> Cellular component: GO:0000780 [condensed nuclear chromosome, centromeric region] evidence: IEA
            GeneID:151648 -> Cellular component: GO:0000922 [spindle pole] evidence: IDA
            GeneID:151648 -> Cellular component: GO:0005813 [centrosome] evidence: IDA
            GeneID:151648 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
            GeneID:151648 -> Cellular component: GO:0030892 [mitotic cohesin complex] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.