Home |
Help |
Advanced search
2024-04-25 01:18:06, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001012270 2537 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens baculoviral IAP repeat containing 5 (BIRC5),
transcript variant 2, mRNA.
ACCESSION NM_001012270
VERSION NM_001012270.1 GI:59859879
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2537)
AUTHORS Wen,K., Fu,Z., Wu,X., Feng,J., Chen,W. and Qian,J.
TITLE Oct-4 is required for an antiapoptotic behavior of chemoresistant
colorectal cancer cells enriched for cancer stem cells: effects
associated with STAT3/Survivin
JOURNAL Cancer Lett. 333 (1), 56-65 (2013)
PUBMED 23340171
REMARK GeneRIF: show that these events can be at least in part attributed
to the STAT3/Survivin pathway
REFERENCE 2 (bases 1 to 2537)
AUTHORS Kan,C.Y., Petti,C., Bracken,L., Maritz,M., Xu,N., O'Brien,R.,
Yang,C., Liu,T., Yuan,J., Lock,R.B. and MacKenzie,K.L.
TITLE Up-regulation of survivin during immortalization of human
myofibroblasts is linked to repression of tumor suppressor
p16(INK4a) protein and confers resistance to oxidative stress
JOURNAL J. Biol. Chem. 288 (17), 12032-12041 (2013)
PUBMED 23449974
REMARK GeneRIF: Up-regulation of survivin during immortalization of human
myofibroblasts is linked to repression of tumor suppressor
p16(INK4a) protein and confers resistance to oxidative stress.
REFERENCE 3 (bases 1 to 2537)
AUTHORS Ju,J.H., Yang,W., Oh,S., Nam,K., Lee,K.M., Noh,D.Y. and Shin,I.
TITLE HER2 stabilizes survivin while concomitantly down-regulating
survivin gene transcription by suppressing Notch cleavage
JOURNAL Biochem. J. 451 (1), 123-134 (2013)
PUBMED 23323858
REMARK GeneRIF: HER2 stabilizes survivin while concomitantly
down-regulating survivin gene transcription by suppressing Notch
cleavage.
REFERENCE 4 (bases 1 to 2537)
AUTHORS Hmeljak,J., Erculj,N., Dolzan,V., Pizem,J., Kern,I., Kovac,V.,
Cemazar,M. and Cor,A.
TITLE Is survivin expression prognostic or predictive in malignant
pleural mesothelioma?
JOURNAL Virchows Arch. 462 (3), 315-321 (2013)
PUBMED 23358691
REMARK GeneRIF: Survivin was highly expressed in tumour cell nuclei in all
samples of malignant pleural mesothelioma and this correlated
positively with both apoptosis and proliferation, but did not have
a significant prognostic value
REFERENCE 5 (bases 1 to 2537)
AUTHORS Mao,X.J., Wang,G.F., Chen,Z.J., Wang,L.N., Zhang,J.B. and Wang,H.L.
TITLE Expression of HMGB1 and its clinical significance in T-cell
lymphoma
JOURNAL Asian Pac. J. Cancer Prev. 13 (11), 5569-5571 (2012)
PUBMED 23317219
REMARK GeneRIF: High expression of survivin is associated with T-cell
lymphoma.
REFERENCE 6 (bases 1 to 2537)
AUTHORS Tamm,I., Wang,Y., Sausville,E., Scudiero,D.A., Vigna,N.,
Oltersdorf,T. and Reed,J.C.
TITLE IAP-family protein survivin inhibits caspase activity and apoptosis
induced by Fas (CD95), Bax, caspases, and anticancer drugs
JOURNAL Cancer Res. 58 (23), 5315-5320 (1998)
PUBMED 9850056
REFERENCE 7 (bases 1 to 2537)
AUTHORS Ambrosini,G., Adida,C., Sirugo,G. and Altieri,D.C.
TITLE Induction of apoptosis and inhibition of cell proliferation by
survivin gene targeting
JOURNAL J. Biol. Chem. 273 (18), 11177-11182 (1998)
PUBMED 9556606
REFERENCE 8 (bases 1 to 2537)
AUTHORS Ambrosini,G., Adida,C. and Altieri,D.C.
TITLE A novel anti-apoptosis gene, survivin, expressed in cancer and
lymphoma
JOURNAL Nat. Med. 3 (8), 917-921 (1997)
PUBMED 9256286
REFERENCE 9 (bases 1 to 2537)
AUTHORS Altieri,D.C.
TITLE Splicing of effector cell protease receptor-1 mRNA is modulated by
an unusual retained intron
JOURNAL Biochemistry 33 (46), 13848-13855 (1994)
PUBMED 7947793
REFERENCE 10 (bases 1 to 2537)
AUTHORS Altieri,D.C.
TITLE Molecular cloning of effector cell protease receptor-1, a novel
cell surface receptor for the protease factor Xa
JOURNAL J. Biol. Chem. 269 (5), 3139-3142 (1994)
PUBMED 8106347
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BI520186.1, AL547142.3,
BG178974.1, BM476145.1, BC008718.2, AL519719.3, BI254058.1 and
AI800528.1.
Summary: This gene is a member of the inhibitor of apoptosis (IAP)
gene family, which encode negative regulatory proteins that prevent
apoptotic cell death. IAP family members usually contain multiple
baculovirus IAP repeat (BIR) domains, but this gene encodes
proteins with only a single BIR domain. The encoded proteins also
lack a C-terminus RING finger domain. Gene expression is high
during fetal development and in most tumors, yet low in adult
tissues. Alternatively spliced transcript variants encoding
distinct isoforms have been found for this gene. [provided by
RefSeq, Jun 2011].
Transcript Variant: This variant (2), also known as
survivin-deltaEx3, lacks an exon in the 3' coding region which
results in a frameshift, compared to variant 1. The encoded isoform
(2) is shorter and has a distinct C-terminus when it is compared to
isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC000784.2, AL547142.3 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025087 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-68 BI520186.1 11-78
69-387 AL547142.3 1-319
388-482 BG178974.1 304-398
483-934 BM476145.1 241-692
935-1577 BC008718.2 965-1607
1578-2166 AL519719.3 269-857
2167-2492 BI254058.1 14-339 c
2493-2537 AI800528.1 1-45 c
FEATURES Location/Qualifiers
source 1..2537
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="17"
/map="17q25"
gene 1..2537
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/note="baculoviral IAP repeat containing 5"
/db_xref="GeneID:332"
/db_xref="HGNC:593"
/db_xref="HPRD:04520"
/db_xref="MIM:603352"
exon 1..232
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/inference="alignment:Splign:1.39.8"
misc_feature 83..85
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/note="upstream in-frame stop codon"
variation 91
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:9904341"
variation 98
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:202101234"
variation 112
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:373880047"
CDS 122..535
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/note="isoform 2 is encoded by transcript variant 2;
survivin variant 3 alpha; apoptosis inhibitor 4;
baculoviral IAP repeat-containing protein 5; apoptosis
inhibitor survivin"
/codon_start=1
/product="baculoviral IAP repeat-containing protein 5
isoform 2"
/protein_id="NP_001012270.1"
/db_xref="GI:59859880"
/db_xref="CCDS:CCDS32751.1"
/db_xref="GeneID:332"
/db_xref="HGNC:593"
/db_xref="HPRD:04520"
/db_xref="MIM:603352"
/translation="
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPMQRKPTIRRKNLRKLRRKCAVPSSSWLPWIEASGRSCLVPEWLHHFQGLFPGATSLPVGPLAMS
"
misc_feature 167..>349
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/note="Baculoviral inhibition of apoptosis protein repeat
domain; Found in inhibitors of apoptosis proteins (IAPs)
and other proteins. In higher eukaryotes, BIR domains
inhibit apoptosis by acting as direct inhibitors of the
caspase family of protease enzymes; Region: BIR; cd00022"
/db_xref="CDD:28906"
misc_feature 221..223
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:00302"
misc_feature order(257..259,281..283,287..289,308..316,320..322,
332..334,347..349)
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/note="peptide binding groove; other site"
/db_xref="CDD:28906"
misc_feature order(290..292,299..301)
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/note="Zn2+ binding site [ion binding]; other site"
/db_xref="CDD:28906"
variation 146
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:143160639"
variation 180
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:372753451"
variation 205
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:370361101"
variation 211
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:145526644"
variation 226
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:148424824"
exon 233..342
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/inference="alignment:Splign:1.39.8"
variation 251
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="t"
/db_xref="dbSNP:142624012"
STS 252..407
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/standard_name="STS-L26245"
/db_xref="UniSTS:19812"
variation 286
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:371312590"
exon 343..2513
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/inference="alignment:Splign:1.39.8"
variation 369
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:150188047"
variation 386
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:201354179"
variation 387
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:138842857"
variation 388
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:2071214"
variation 397
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:143777433"
variation 400
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:375947077"
variation 408
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:17880183"
variation 443
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:112471026"
variation 454
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:370922732"
variation 478
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:373086357"
variation 482
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:17885521"
variation 484
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:377394472"
variation 528
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:140169554"
variation 536
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:17882627"
variation 574
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:188097548"
variation 580
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:2239680"
variation 581..582
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace=""
/replace="aa"
/replace="aag"
/db_xref="dbSNP:17882139"
variation 653..656
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace=""
/replace="tctc"
/db_xref="dbSNP:369792774"
STS 690..1569
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/standard_name="BIRC5_44"
/db_xref="UniSTS:276165"
variation 711
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:138133959"
variation 742
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:17879146"
variation 775
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:141087478"
variation 776
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:17878866"
variation 844
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:186338705"
variation 909
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:376324020"
variation 924..926
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace=""
/replace="ttg"
/db_xref="dbSNP:146639575"
variation 930..940
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace=""
/replace="ttgtgtttttt"
/db_xref="dbSNP:373960358"
variation 930
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace=""
/replace="t"
/db_xref="dbSNP:202011142"
variation 931
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:199602253"
variation 932
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:200361238"
variation 934
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:201472247"
variation 935
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace=""
/replace="aa"
/db_xref="dbSNP:71309113"
variation 942
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:77903511"
variation 953
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:113519837"
variation 1003
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1042489"
variation 1022
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:144790144"
variation 1168
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:138703176"
variation 1225
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:79824097"
variation 1241
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:191250920"
variation 1296
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:17878624"
variation 1365
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:181761491"
variation 1406
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:150652785"
variation 1411
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:377708686"
variation 1434
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:2856269"
variation 1501
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:17878377"
variation 1513
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:17885994"
variation 1517
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:191137126"
variation 1541
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:138794504"
polyA_signal 1555..1560
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
polyA_site 1580
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/experiment="experimental evidence, no additional details
recorded"
variation 1655
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:111816792"
variation 1667
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:17885394"
variation 1704
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:149352631"
variation 1711
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:373191333"
variation 1805
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:2661694"
variation 1873
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:183312799"
variation 1925
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:186938477"
variation 1983
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:370504799"
variation 2042
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:17884909"
variation 2099
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:17883788"
variation 2100
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:17879923"
variation 2113
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:140212651"
variation 2122
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:17879624"
variation 2166..2167
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:3088210"
variation 2167
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:1042541"
polyA_signal 2199..2204
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
variation 2225
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1042542"
polyA_site 2229
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/experiment="experimental evidence, no additional details
recorded"
variation 2232
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:145698232"
variation 2242
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:17885897"
variation 2259
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:4789560"
variation 2399
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="t"
/db_xref="dbSNP:17882360"
variation 2409
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:59214380"
polyA_signal 2488..2493
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
variation 2489
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:74532139"
variation 2495
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11655530"
polyA_site 2513
/gene="BIRC5"
/gene_synonym="API4; EPR-1"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
cccagaaggccgcggggggtggaccgcctaagagggcgtgcgctcccgacatgccccgcggcgcgccattaaccgccagatttgaatcgcgggacccgttggcagaggtggcggcggcggcatgggtgccccgacgttgccccctgcctggcagccctttctcaaggaccaccgcatctctacattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgaggctggcttcatccactgccccactgagaacgagccagacttggcccagtgtttcttctgcttcaaggagctggaaggctgggagccagatgacgaccccatgcaaaggaaaccaacaataagaagaaagaatttgaggaaactgcggagaaagtgcgccgtgccatcgagcagctggctgccatggattgaggcctctggccggagctgcctggtcccagagtggctgcaccacttccagggtttattccctggtgccaccagccttcctgtgggccccttagcaatgtcttaggaaaggagatcaacattttcaaattagatgtttcaactgtgctcttgttttgtcttgaaagtggcaccagaggtgcttctgcctgtgcagcgggtgctgctggtaacagtggctgcttctctctctctctctcttttttgggggctcatttttgctgttttgattcccgggcttaccaggtgagaagtgagggaggaagaaggcagtgtcccttttgctagagctgacagctttgttcgcgtgggcagagccttccacagtgaatgtgtctggacctcatgttgttgaggctgtcacagtcctgagtgtggacttggcaggtgcctgttgaatctgagctgcaggttccttatctgtcacacctgtgcctcctcagaggacagtttttttgttgttgtgtttttttgtttttttttttttggtagatgcatgacttgtgtgtgatgagagaatggagacagagtccctggctcctctactgtttaacaacatggctttcttattttgtttgaattgttaattcacagaatagcacaaactacaattaaaactaagcacaaagccattctaagtcattggggaaacggggtgaacttcaggtggatgaggagacagaatagagtgataggaagcgtctggcagatactccttttgccactgctgtgtgattagacaggcccagtgagccgcggggcacatgctggccgctcctccctcagaaaaaggcagtggcctaaatcctttttaaatgacttggctcgatgctgtgggggactggctgggctgctgcaggccgtgtgtctgtcagcccaaccttcacatctgtcacgttctccacacgggggagagacgcagtccgcccaggtccccgctttctttggaggcagcagctcccgcagggctgaagtctggcgtaagatgatggatttgattcgccctcctccctgtcatagagctgcagggtggattgttacagcttcgctggaaacctctggaggtcatctcggctgttcctgagaaataaaaagcctgtcatttcaaacactgctgtggaccctactgggtttttaaaatattgtcagtttttcatcgtcgtccctagcctgccaacagccatctgcccagacagccgcagtgaggatgagcgtcctggcagagacgcagttgtctctgggcgcttgccagagccacgaaccccagacctgtttgtatcatccgggctccttccgggcagaaacaactgaaaatgcacttcagacccacttatttctgccacatctgagtcggcctgagatagacttttccctctaaactgggagaatatcacagtggtttttgttagcagaaaatgcactccagcctctgtactcatctaagctgcttatttttgatatttgtgtcagtctgtaaatggatacttcactttaataactgttgcttagtaattggctttgtagagaagctggaaaaaaatggttttgtcttcaactcctttgcatgccaggcggtgatgtggatctcggcttctgtgagcctgtgctgtgggcagggctgagctggagccgcccctctcagcccgcctgccacggcctttccttaaaggccatccttaaaaccagaccctcatggctaccagcacctgaaagcttcctcgacatctgttaataaagccgtaggcccttgtctaagtgcaaccgcctagactttctttcagatacatgtccacatgtccatttttcaggttctctaagttggagtggagtctgggaagggttgtgaatgaggcttctgggctatgggtgaggttccaatggcaggttagagcccctcgggccaactgccatcctggaaagtagagacagcagtgcccgctgcccagaagagaccagcaagccaaactggagcccccattgcaggctgtcgccatgtggaaagagtaactcacaattgccaataaagtctcatgtggttttatctaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:332 -> Molecular function: GO:0004869 [cysteine-type endopeptidase inhibitor activity] evidence: IEA
GeneID:332 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:332 -> Molecular function: GO:0008017 [microtubule binding] evidence: IDA
GeneID:332 -> Molecular function: GO:0008017 [microtubule binding] evidence: TAS
GeneID:332 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IDA
GeneID:332 -> Molecular function: GO:0008270 [zinc ion binding] evidence: NAS
GeneID:332 -> Molecular function: GO:0008536 [Ran GTPase binding] evidence: IPI
GeneID:332 -> Molecular function: GO:0015631 [tubulin binding] evidence: IDA
GeneID:332 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI
GeneID:332 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI
GeneID:332 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA
GeneID:332 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IPI
GeneID:332 -> Molecular function: GO:0043027 [cysteine-type endopeptidase inhibitor activity involved in apoptotic process] evidence: IMP
GeneID:332 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
GeneID:332 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IDA
GeneID:332 -> Molecular function: GO:0048037 [cofactor binding] evidence: IDA
GeneID:332 -> Molecular function: GO:0050897 [cobalt ion binding] evidence: NAS
GeneID:332 -> Molecular function: GO:0051087 [chaperone binding] evidence: IPI
GeneID:332 -> Biological process: GO:0000086 [G2/M transition of mitotic cell cycle] evidence: IDA
GeneID:332 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:332 -> Biological process: GO:0000910 [cytokinesis] evidence: IMP
GeneID:332 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
GeneID:332 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:332 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:332 -> Biological process: GO:0007059 [chromosome segregation] evidence: IEA
GeneID:332 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:332 -> Biological process: GO:0007067 [mitosis] evidence: TAS
GeneID:332 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: TAS
GeneID:332 -> Biological process: GO:0031503 [protein complex localization] evidence: IMP
GeneID:332 -> Biological process: GO:0031536 [positive regulation of exit from mitosis] evidence: IMP
GeneID:332 -> Biological process: GO:0031577 [spindle checkpoint] evidence: IMP
GeneID:332 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA
GeneID:332 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IMP
GeneID:332 -> Biological process: GO:0043154 [negative regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA
GeneID:332 -> Biological process: GO:0043154 [negative regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IMP
GeneID:332 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IMP
GeneID:332 -> Biological process: GO:0045931 [positive regulation of mitotic cell cycle] evidence: IMP
GeneID:332 -> Biological process: GO:0051301 [cell division] evidence: IEA
GeneID:332 -> Biological process: GO:0051301 [cell division] evidence: IMP
GeneID:332 -> Biological process: GO:0051303 [establishment of chromosome localization] evidence: IMP
GeneID:332 -> Cellular component: GO:0000228 [nuclear chromosome] evidence: IDA
GeneID:332 -> Cellular component: GO:0000775 [chromosome, centromeric region] evidence: IDA
GeneID:332 -> Cellular component: GO:0000777 [condensed chromosome kinetochore] evidence: IDA
GeneID:332 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:332 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:332 -> Cellular component: GO:0005814 [centriole] evidence: IDA
GeneID:332 -> Cellular component: GO:0005819 [spindle] evidence: IEA
GeneID:332 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
GeneID:332 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:332 -> Cellular component: GO:0005874 [microtubule] evidence: IEA
GeneID:332 -> Cellular component: GO:0005876 [spindle microtubule] evidence: IDA
GeneID:332 -> Cellular component: GO:0005881 [cytoplasmic microtubule] evidence: IDA
GeneID:332 -> Cellular component: GO:0030496 [midbody] evidence: IDA
GeneID:332 -> Cellular component: GO:0031021 [interphase microtubule organizing center] evidence: IDA
GeneID:332 -> Cellular component: GO:0032133 [chromosome passenger complex] evidence: IPI
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.