Home |
Help |
Advanced search
2024-04-20 23:02:59, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001007098 2150 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens sterol carrier protein 2 (SCP2), transcript variant 2,
mRNA.
ACCESSION NM_001007098
VERSION NM_001007098.2 GI:302318894
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2150)
AUTHORS Williams,C.P., Schueller,N., Thompson,C.A., van den Berg,M., Van
Haren,S.D., Erdmann,R., Bond,C.S., Distel,B., Schliebs,W.,
Wilmanns,M. and Stanley,W.A.
TITLE The Peroxisomal Targeting Signal 1 in sterol carrier protein 2 is
autonomous and essential for receptor recognition
JOURNAL BMC Biochem. 12, 12 (2011)
PUBMED 21375735
REMARK GeneRIF: The Peroxisomal targeting signal 1 in Scp2 is autonomous
and is essential for binding to pex5.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 2150)
AUTHORS Shimada,M., Miyagawa,T., Kawashima,M., Tanaka,S., Honda,Y.,
Honda,M. and Tokunaga,K.
TITLE An approach based on a genome-wide association study reveals
candidate loci for narcolepsy
JOURNAL Hum. Genet. 128 (4), 433-441 (2010)
PUBMED 20677014
REMARK GeneRIF: Statistical analysis indicated that six genes, NFATC2,
SCP2, CACNA1C, TCRA, POLE, and FAM3D, were associated with
narcolepsy.
GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 3 (bases 1 to 2150)
AUTHORS Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M.,
Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D.,
Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J.
TITLE Genetic variants in nuclear-encoded mitochondrial genes influence
AIDS progression
JOURNAL PLoS ONE 5 (9), E12862 (2010)
PUBMED 20877624
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 2150)
AUTHORS Dansen,T.B., Kops,G.J., Denis,S., Jelluma,N., Wanders,R.J.,
Bos,J.L., Burgering,B.M. and Wirtz,K.W.
TITLE Regulation of sterol carrier protein gene expression by the
forkhead transcription factor FOXO3a
JOURNAL J. Lipid Res. 45 (1), 81-88 (2004)
PUBMED 14563822
REMARK GeneRIF: SCP2 in the cellular defense against oxidative damage and
found that a fluorescent fatty acid analog bound to SCP2 is
protected against H2O2/Cu2+-induced oxidative damage
REFERENCE 5 (bases 1 to 2150)
AUTHORS Ohba,T., Holt,J.A., Billheimer,J.T. and Strauss,J.F. III.
TITLE Human sterol carrier protein x/sterol carrier protein 2 gene has
two promoters
JOURNAL Biochemistry 34 (33), 10660-10668 (1995)
PUBMED 7654720
REFERENCE 6 (bases 1 to 2150)
AUTHORS Ohba,T., Rennert,H., Pfeifer,S.M., He,Z., Yamamoto,R., Holt,J.A.,
Billheimer,J.T. and Strauss,J.F. III.
TITLE The structure of the human sterol carrier protein X/sterol carrier
protein 2 gene (SCP2)
JOURNAL Genomics 24 (2), 370-374 (1994)
PUBMED 7698762
REFERENCE 7 (bases 1 to 2150)
AUTHORS Seedorf,U., Brysch,P., Engel,T., Schrage,K. and Assmann,G.
TITLE Sterol carrier protein X is peroxisomal 3-oxoacyl coenzyme A
thiolase with intrinsic sterol carrier and lipid transfer activity
JOURNAL J. Biol. Chem. 269 (33), 21277-21283 (1994)
PUBMED 8063752
REFERENCE 8 (bases 1 to 2150)
AUTHORS Yamamoto,R.
TITLE [Localization of human sterol carrier protein 2 gene and cDNA
expression in COS-7 cell]
JOURNAL Hokkaido Igaku Zasshi 67 (6), 839-848 (1992)
PUBMED 1483685
REFERENCE 9 (bases 1 to 2150)
AUTHORS Heikoop,J.C., Ossendorp,B.C., Wanders,R.J., Wirtz,K.W. and
Tager,J.M.
TITLE Subcellular localisation and processing of non-specific lipid
transfer protein are not aberrant in Rhizomelic Chondrodysplasia
Punctata fibroblasts
JOURNAL FEBS Lett. 299 (2), 201-204 (1992)
PUBMED 1347505
REFERENCE 10 (bases 1 to 2150)
AUTHORS Yamamoto,R., Kallen,C.B., Babalola,G.O., Rennert,H.,
Billheimer,J.T. and Strauss,J.F. III.
TITLE Cloning and expression of a cDNA encoding human sterol carrier
protein 2
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 88 (2), 463-467 (1991)
PUBMED 1703300
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AC099677.2, DC330171.1,
BC067108.1 and AL445183.19.
On Aug 6, 2010 this sequence version replaced gi:55956774.
Summary: This gene encodes two proteins: sterol carrier protein X
(SCPx) and sterol carrier protein 2 (SCP2), as a result of
transcription initiation from 2 independently regulated promoters.
The transcript initiated from the proximal promoter encodes the
longer SCPx protein, and the transcript initiated from the distal
promoter encodes the shorter SCP2 protein, with the 2 proteins
sharing a common C-terminus. Evidence suggests that the SCPx
protein is a peroxisome-associated thiolase that is involved in the
oxidation of branched chain fatty acids, while the SCP2 protein is
thought to be an intracellular lipid transfer protein. This gene is
highly expressed in organs involved in lipid metabolism, and may
play a role in Zellweger syndrome, in which cells are deficient in
peroxisomes and have impaired bile acid synthesis. Alternative
splicing of this gene produces multiple transcript variants, some
encoding different isoforms.[provided by RefSeq, Aug 2010].
Transcript Variant: This variant (2) has multiple differences in
the coding region, compared to variant 1, one of which results in a
translational frameshift. The resulting isoform (2) is shorter and
has a distinct C-terminus, compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC067108.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025083, ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-16 AC099677.2 88079-88094
17-89 DC330171.1 1-73
90-1464 BC067108.1 1-1375
1465-1779 AL445183.19 40219-40533
1780-2150 BC067108.1 1690-2060
FEATURES Location/Qualifiers
source 1..2150
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1p32"
gene 1..2150
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/note="sterol carrier protein 2"
/db_xref="GeneID:6342"
/db_xref="HGNC:10606"
/db_xref="HPRD:01700"
/db_xref="MIM:184755"
exon 1..237
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 8
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1242331"
variation 82
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="g"
/db_xref="dbSNP:184943760"
variation 89
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="t"
/db_xref="dbSNP:115810571"
variation 112
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:140752743"
CDS 169..1137
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/EC_number="2.3.1.176"
/note="isoform 2 is encoded by transcript variant 2;
sterol carrier protein X; non-specific lipid-transfer
protein; propanoyl-CoA C-acyltransferase"
/codon_start=1
/product="non-specific lipid-transfer protein isoform 2"
/protein_id="NP_001007099.1"
/db_xref="GI:55956775"
/db_xref="CCDS:CCDS41338.1"
/db_xref="GeneID:6342"
/db_xref="HGNC:10606"
/db_xref="HPRD:01700"
/db_xref="MIM:184755"
/translation="
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGGHSCS
"
misc_feature 217..1134
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/note="nondecarboxylating condensing enzymes; In general,
thiolases catalyze the reversible thiolytic cleavage of
3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step
reaction involving a covalent intermediate formed with a
catalytic cysteine. There are 2...; Region:
nondecarbox_cond_enzymes; cd00826"
/db_xref="CDD:73239"
misc_feature 625..627
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 646..648
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
variation 183
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="g"
/replace="t"
/db_xref="dbSNP:147697594"
variation 185
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="g"
/db_xref="dbSNP:148709071"
variation 202
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:190197851"
variation 223
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="g"
/db_xref="dbSNP:140387282"
variation 225
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="t"
/db_xref="dbSNP:369597903"
variation 235
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="c"
/db_xref="dbSNP:149958725"
exon 238..295
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
exon 296..367
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 300
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:184974273"
variation 304
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:144647557"
variation 305
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:377136053"
variation 350
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:370413647"
exon 368..432
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 384
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:202234745"
variation 414
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:369066062"
exon 433..559
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 452
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="g"
/db_xref="dbSNP:11552393"
variation 455
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="g"
/db_xref="dbSNP:201992866"
variation 468
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:372729186"
variation 490
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:377683847"
variation 517
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:376277989"
exon 560..623
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 567
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="t"
/db_xref="dbSNP:143441016"
variation 608
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:372168791"
variation 611
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:200541507"
exon 624..710
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 645
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:41294530"
variation 708
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:371534398"
exon 711..861
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 723
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:80033039"
variation 760
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:201599199"
variation 767
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:201663646"
variation 814
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:112110457"
variation 832
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:113895458"
variation 834
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:148510961"
exon 862..1009
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 891
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:185811440"
variation 920
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="c"
/db_xref="dbSNP:370185824"
variation 936
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:148423275"
variation 937
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:374102289"
variation 969
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:368088577"
variation 978
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="g"
/replace="t"
/db_xref="dbSNP:3189884"
variation 993
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="g"
/db_xref="dbSNP:1130712"
exon 1010..1117
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 1023
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="g"
/replace="t"
/db_xref="dbSNP:7538935"
variation 1110
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:74638331"
variation 1112
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:201780891"
exon 1118..2092
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/inference="alignment:Splign:1.39.8"
variation 1121
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="g"
/db_xref="dbSNP:372915189"
variation 1159
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:201228419"
variation 1185
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="c"
/db_xref="dbSNP:375849525"
variation 1232
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:41294532"
variation 1243
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:182127561"
variation 1244
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:117140349"
variation 1321
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:186801373"
variation 1342
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="t"
/db_xref="dbSNP:41294534"
variation 1367
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="g"
/replace="t"
/db_xref="dbSNP:201962271"
variation 1369
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="c"
/db_xref="dbSNP:115255694"
variation 1464
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace=""
/replace="g"
/replace="t"
/db_xref="dbSNP:76633416"
variation 1465
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace=""
/replace="g"
/db_xref="dbSNP:111632142"
variation 1482
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:192166984"
variation 1549
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="g"
/replace="t"
/db_xref="dbSNP:150459731"
variation 1550
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:6697076"
variation 1618
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:75660274"
variation 1638
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:183946230"
variation 1649
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:6657017"
variation 1705
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:188594598"
variation 1779
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:116111940"
variation 1878
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:11581638"
variation 2001
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="g"
/replace="t"
/db_xref="dbSNP:377498178"
variation 2034
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="c"
/replace="t"
/db_xref="dbSNP:137967000"
polyA_signal 2063..2068
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
variation 2083
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
/replace="a"
/replace="g"
/db_xref="dbSNP:376016258"
polyA_site 2092
/gene="SCP2"
/gene_synonym="NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX"
ORIGIN
gcgccccaccccgccccctcctcctgcccctacgcacgcgcactctcacgcgcctgtgttgccgcccgcggccctggcttcgggcttcagggagctctggtgcagtctccgcctgtcagtgccggcagtcgtccgcggcgcccgccccggtcccgcactggtgcagccatgtcctcttccccgtgggagcctgcgaccctgcgccgggtgttcgtggtgggggttggcatgaccaagtttgtgaagcctggagctgagaattcaagagactaccctgacttggcagaagaagcaggcaagaaggctttagctgatgcacagatcccttattcagcagtggaccaggcatgtgttggctatgtttttggtgtggcagaatgtgtcttggctcttgggtttgagaagatgagtaagggaagccttggaataaaattttcagatagaaccattcccactgataagcatgttgacctcctgatcaataagtatggattgtctgctcacccagttgctcctcagatgtttgggtatgctggaaaagaacatatggaaaaatatggaacaaaaattgaacactttgcaaaaattggatggaaaaatcataaacattcagttaataacccgtattcccagttccaagatgaatacagtttagatgaagtgatggcatctaaagaagtttttgattttttgactatcttacaatgttgtcccacttcagatggtgctgcagcagcaattttggccagtgaagcatttgtacagaagtatggcctgcaatccaaagctgtggaaattttggcacaagaaatgatgactgatttgccaagctcgtttgaagaaaaaagcattattaaaatggttggctttgatatgagtaaagaagctgcaagaaaatgctatgagaaatctggcctgacaccaaatgatattgacgtaatagaacttcacgattgcttttctaccaacgaactccttacttatgaagcactgggactctgtccagaaggacaaggtgcaacgctggttgatagaggagataatacatatggaggaaagtgggtcataaatcctagtggtggactgatttcaaagggacacccactaggcgctacaggaggacattcctgctcttgaaatttcctgataacccggacaagttcatggaaagcttgatctacattcatcctaatctttgctgatgcctccatgtatgttaccttaagttgccgtgctaactgccgtccttcttcctgtgttacctgtctttgatgatccagatctgctttattaccaattaaaatcattgggaactcatcacgatcctttactctgagaatctgtctttgaaacttatagatttcttcaaaactgcctctatctgtgactgaaaagaccaacaggaagccctcgccagtcctcatatactgttctctcatggctccaagctcttcttgtcctgctgtatccaaaatatctagccgggctgctctgtcatctatcacacactgctttgtgtaagaatcttcattggttggatcataatccgttacaaaataggactcccaacttaggaaacaaaacatttgtaatatgattgaagactcctgcatgcctcctcaataatattcccctctctcctcccccagcaccaagaggtaatcaatatcctgaatttggtatctgtcattctcatgcatttatacaacattagtaatcatatgatagtattcctaagctatgttttggagaggacaccactgcaaatcttcagccctatactagcttttatcggtagccatcaattgcagttttaatagaaatacaaatacatcaagtgtctgttctttaatttgtaaagaaaatttgttttctagcgtgacaccctcaaggtaccgtatctgtatgtaaatgttgtgcccaatgctacacagacattattttaaaactattttctgcctttggtaaatagactaaactgttttctttattcctcaaaagaattagatcatacttcagtgttgattttgttgctaatgggacatggagatgtctggatgataataaatattcctgtggtatggtcactgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:6342 -> Molecular function: GO:0000062 [fatty-acyl-CoA binding] evidence: IDA
GeneID:6342 -> Molecular function: GO:0005102 [receptor binding] evidence: IPI
GeneID:6342 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:6342 -> Molecular function: GO:0008526 [phosphatidylinositol transporter activity] evidence: IDA
GeneID:6342 -> Molecular function: GO:0015485 [cholesterol binding] evidence: IDA
GeneID:6342 -> Molecular function: GO:0033814 [propanoyl-CoA C-acyltransferase activity] evidence: IEA
GeneID:6342 -> Molecular function: GO:0036042 [long-chain fatty acyl-CoA binding] evidence: IDA
GeneID:6342 -> Molecular function: GO:0070538 [oleic acid binding] evidence: IDA
GeneID:6342 -> Biological process: GO:0006694 [steroid biosynthetic process] evidence: IDA
GeneID:6342 -> Biological process: GO:0006699 [bile acid biosynthetic process] evidence: TAS
GeneID:6342 -> Biological process: GO:0006701 [progesterone biosynthetic process] evidence: IDA
GeneID:6342 -> Biological process: GO:0006869 [lipid transport] evidence: IEA
GeneID:6342 -> Biological process: GO:0007031 [peroxisome organization] evidence: IEA
GeneID:6342 -> Biological process: GO:0008206 [bile acid metabolic process] evidence: TAS
GeneID:6342 -> Biological process: GO:0015914 [phospholipid transport] evidence: IDA
GeneID:6342 -> Biological process: GO:0032385 [positive regulation of intracellular cholesterol transport] evidence: IDA
GeneID:6342 -> Biological process: GO:0032385 [positive regulation of intracellular cholesterol transport] evidence: NAS
GeneID:6342 -> Biological process: GO:0032959 [inositol trisphosphate biosynthetic process] evidence: IDA
GeneID:6342 -> Biological process: GO:0033540 [fatty acid beta-oxidation using acyl-CoA oxidase] evidence: TAS
GeneID:6342 -> Biological process: GO:0033559 [unsaturated fatty acid metabolic process] evidence: TAS
GeneID:6342 -> Biological process: GO:0036109 [alpha-linolenic acid metabolic process] evidence: TAS
GeneID:6342 -> Biological process: GO:0044255 [cellular lipid metabolic process] evidence: TAS
GeneID:6342 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:6342 -> Biological process: GO:0045940 [positive regulation of steroid metabolic process] evidence: IDA
GeneID:6342 -> Biological process: GO:0072659 [protein localization to plasma membrane] evidence: IDA
GeneID:6342 -> Biological process: GO:1901373 [lipid hydroperoxide transport] evidence: IDA
GeneID:6342 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:6342 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
GeneID:6342 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:6342 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA
GeneID:6342 -> Cellular component: GO:0005777 [peroxisome] evidence: IDA
GeneID:6342 -> Cellular component: GO:0005782 [peroxisomal matrix] evidence: TAS
GeneID:6342 -> Cellular component: GO:0043231 [intracellular membrane-bounded organelle] evidence: IDA
GeneID:6342 -> Cellular component: GO:0043234 [protein complex] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001007099 -> EC 2.3.1.176
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.