Home |
Help |
Advanced search
2024-04-26 12:07:46, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001001852 2410 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens pim-3 oncogene (PIM3), mRNA.
ACCESSION NM_001001852 XM_497821
VERSION NM_001001852.3 GI:224591415
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2410)
AUTHORS Tahvanainen,J., Kylaniemi,M.K., Kanduri,K., Gupta,B.,
Lahteenmaki,H., Kallonen,T., Rajavuori,A., Rasool,O.,
Koskinen,P.J., Rao,K.V., Lahdesmaki,H. and Lahesmaa,R.
TITLE Proviral integration site for Moloney murine leukemia virus (PIM)
kinases promote human T helper 1 cell differentiation
JOURNAL J. Biol. Chem. 288 (5), 3048-3058 (2013)
PUBMED 23209281
REMARK GeneRIF: PIM kinases promote the production of IFNgamma, the
hallmark cytokine produced by Th1 cells.
REFERENCE 2 (bases 1 to 2410)
AUTHORS Yang,H., Wang,Y., Qian,H., Zhang,P. and Huang,C.
TITLE Pim protein kinase-3 is regulated by TNF-alpha and promotes
endothelial cell sprouting
JOURNAL Mol. Cells 32 (3), 235-241 (2011)
PUBMED 21870113
REMARK GeneRIF: Pim protein kinase-3 is regulated by TNF-alpha and
promotes endothelial cell sprouting.
REFERENCE 3 (bases 1 to 2410)
AUTHORS Agrawal,A., Lynskey,M.T., Hinrichs,A., Grucza,R., Saccone,S.F.,
Krueger,R., Neuman,R., Howells,W., Fisher,S., Fox,L., Cloninger,R.,
Dick,D.M., Doheny,K.F., Edenberg,H.J., Goate,A.M., Hesselbrock,V.,
Johnson,E., Kramer,J., Kuperman,S., Nurnberger,J.I. Jr., Pugh,E.,
Schuckit,M., Tischfield,J., Rice,J.P., Bucholz,K.K. and Bierut,L.J.
CONSRTM GENEVA Consortium
TITLE A genome-wide association study of DSM-IV cannabis dependence
JOURNAL Addict Biol 16 (3), 514-518 (2011)
PUBMED 21668797
REFERENCE 4 (bases 1 to 2410)
AUTHORS Forshell,L.P., Li,Y., Forshell,T.Z., Rudelius,M., Nilsson,L.,
Keller,U. and Nilsson,J.
TITLE The direct Myc target Pim3 cooperates with other Pim kinases in
supporting viability of Myc-induced B-cell lymphomas
JOURNAL Oncotarget 2 (6), 448-460 (2011)
PUBMED 21646687
REMARK GeneRIF: Pim3 cooperates with other Pim kinases in supporting
viability of Myc-induced B-cell lymphomas.
REFERENCE 5 (bases 1 to 2410)
AUTHORS Anderson,C.A., Boucher,G., Lees,C.W., Franke,A., D'Amato,M.,
Taylor,K.D., Lee,J.C., Goyette,P., Imielinski,M., Latiano,A.,
Lagace,C., Scott,R., Amininejad,L., Bumpstead,S., Baidoo,L.,
Baldassano,R.N., Barclay,M., Bayless,T.M., Brand,S., Buning,C.,
Colombel,J.F., Denson,L.A., De Vos,M., Dubinsky,M., Edwards,C.,
Ellinghaus,D., Fehrmann,R.S., Floyd,J.A., Florin,T.,
Franchimont,D., Franke,L., Georges,M., Glas,J., Glazer,N.L.,
Guthery,S.L., Haritunians,T., Hayward,N.K., Hugot,J.P., Jobin,G.,
Laukens,D., Lawrance,I., Lemann,M., Levine,A., Libioulle,C.,
Louis,E., McGovern,D.P., Milla,M., Montgomery,G.W., Morley,K.I.,
Mowat,C., Ng,A., Newman,W., Ophoff,R.A., Papi,L., Palmieri,O.,
Peyrin-Biroulet,L., Panes,J., Phillips,A., Prescott,N.J.,
Proctor,D.D., Roberts,R., Russell,R., Rutgeerts,P., Sanderson,J.,
Sans,M., Schumm,P., Seibold,F., Sharma,Y., Simms,L.A.,
Seielstad,M., Steinhart,A.H., Targan,S.R., van den Berg,L.H.,
Vatn,M., Verspaget,H., Walters,T., Wijmenga,C., Wilson,D.C.,
Westra,H.J., Xavier,R.J., Zhao,Z.Z., Ponsioen,C.Y., Andersen,V.,
Torkvist,L., Gazouli,M., Anagnou,N.P., Karlsen,T.H., Kupcinskas,L.,
Sventoraityte,J., Mansfield,J.C., Kugathasan,S., Silverberg,M.S.,
Halfvarson,J., Rotter,J.I., Mathew,C.G., Griffiths,A.M., Gearry,R.,
Ahmad,T., Brant,S.R., Chamaillard,M., Satsangi,J., Cho,J.H.,
Schreiber,S., Daly,M.J., Barrett,J.C., Parkes,M., Annese,V.,
Hakonarson,H., Radford-Smith,G., Duerr,R.H., Vermeire,S.,
Weersma,R.K. and Rioux,J.D.
TITLE Meta-analysis identifies 29 additional ulcerative colitis risk
loci, increasing the number of confirmed associations to 47
JOURNAL Nat. Genet. 43 (3), 246-252 (2011)
PUBMED 21297633
REMARK Erratum:[Nat Genet. 2011 Sep;43(9):919]
REFERENCE 6 (bases 1 to 2410)
AUTHORS Macdonald,A., Campbell,D.G., Toth,R., McLauchlan,H., Hastie,C.J.
and Arthur,J.S.
TITLE Pim kinases phosphorylate multiple sites on Bad and promote 14-3-3
binding and dissociation from Bcl-XL
JOURNAL BMC Cell Biol. 7, 1 (2006)
PUBMED 16403219
REMARK Publication Status: Online-Only
REFERENCE 7 (bases 1 to 2410)
AUTHORS Fujii,C., Nakamoto,Y., Lu,P., Tsuneyama,K., Popivanova,B.K.,
Kaneko,S. and Mukaida,N.
TITLE Aberrant expression of serine/threonine kinase Pim-3 in
hepatocellular carcinoma development and its role in the
proliferation of human hepatoma cell lines
JOURNAL Int. J. Cancer 114 (2), 209-218 (2005)
PUBMED 15540201
REMARK GeneRIF: Aberrnntly expressed Pim-3 can cause autonomous cell
proliferation or prevent apoptosis in hepatoma cell lines.
REFERENCE 8 (bases 1 to 2410)
AUTHORS Mikkers,H., Nawijn,M., Allen,J., Brouwers,C., Verhoeven,E.,
Jonkers,J. and Berns,A.
TITLE Mice deficient for all PIM kinases display reduced body size and
impaired responses to hematopoietic growth factors
JOURNAL Mol. Cell. Biol. 24 (13), 6104-6115 (2004)
PUBMED 15199164
REFERENCE 9 (bases 1 to 2410)
AUTHORS Chichester,C., Nikitin,F., Ravarini,J.C. and Lisacek,F.
TITLE Consistency checks for characterizing protein forms
JOURNAL Comput Biol Chem 27 (1), 29-35 (2003)
PUBMED 12798037
REFERENCE 10 (bases 1 to 2410)
AUTHORS Eichmann,A., Yuan,L., Breant,C., Alitalo,K. and Koskinen,P.J.
TITLE Developmental expression of pim kinases suggests functions also
outside of the hematopoietic system
JOURNAL Oncogene 19 (9), 1215-1224 (2000)
PUBMED 10713710
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DB482257.1, AB114795.1, CT000425.1 and CR536608.3.
On Mar 6, 2009 this sequence version replaced gi:52138581.
Summary: The protein encoded by this gene belongs to the Ser/Thr
protein kinase family, and PIM subfamily. This gene is
overexpressed in hematological and epithelial tumors and is
associated with MYC coexpression. It plays a role in the regulation
of signal transduction cascades, contributing to both cell
proliferation and survival, and provides a selective advantage in
tumorigenesis. [provided by RefSeq, Jun 2012].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AB114795.1, BC141855.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-18 DB482257.1 4-21
19-112 AB114795.1 1-94
113-500 DB482257.1 116-503
501-1351 AB114795.1 483-1333
1352-1836 CT000425.1 152-636
1837-2074 AB114795.1 1819-2056
2075-2075 CR536608.3 2811-2811
2076-2410 AB114795.1 2058-2392
FEATURES Location/Qualifiers
source 1..2410
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="22"
/map="22q13"
gene 1..2410
/gene="PIM3"
/gene_synonym="pim-3"
/note="pim-3 oncogene"
/db_xref="GeneID:415116"
/db_xref="HGNC:19310"
/db_xref="MIM:610580"
exon 1..538
/gene="PIM3"
/gene_synonym="pim-3"
/inference="alignment:Splign:1.39.8"
variation 18
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:28613475"
STS 56..1552
/gene="PIM3"
/gene_synonym="pim-3"
/db_xref="UniSTS:489008"
variation 113
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:28375915"
variation 130
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="c"
/db_xref="dbSNP:111752560"
misc_feature 154..156
/gene="PIM3"
/gene_synonym="pim-3"
/note="upstream in-frame stop codon"
variation 274
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="g"
/db_xref="dbSNP:185484423"
variation 416
/gene="PIM3"
/gene_synonym="pim-3"
/replace="g"
/replace="t"
/db_xref="dbSNP:150609497"
CDS 454..1434
/gene="PIM3"
/gene_synonym="pim-3"
/EC_number="2.7.11.1"
/note="serine/threonine kinase Pim-3"
/codon_start=1
/product="serine/threonine-protein kinase pim-3"
/protein_id="NP_001001852.2"
/db_xref="GI:224591416"
/db_xref="CCDS:CCDS33678.1"
/db_xref="GeneID:415116"
/db_xref="HGNC:19310"
/db_xref="MIM:610580"
/translation="
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL
"
misc_feature 571..1332
/gene="PIM3"
/gene_synonym="pim-3"
/note="Protein kinase domain; Region: Pkinase; pfam00069"
/db_xref="CDD:200973"
misc_feature 589..1326
/gene="PIM3"
/gene_synonym="pim-3"
/note="Catalytic domain of Protein Kinases; Region: PKc;
cd00180"
/db_xref="CDD:173623"
misc_feature order(589..603,613..615,652..654,658..660,772..774,
820..831,844..846,850..852,961..963,967..969,973..978,
982..984,1018..1020,1027..1029,1069..1080)
/gene="PIM3"
/gene_synonym="pim-3"
/note="active site"
/db_xref="CDD:173623"
misc_feature order(589..603,613..615,652..654,658..660,772..774,
820..831,844..846,961..963,967..969,973..978,982..984,
1018..1020)
/gene="PIM3"
/gene_synonym="pim-3"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173623"
misc_feature order(601..603,844..846,850..852,961..963,967..969,
973..975,1027..1029,1069..1080)
/gene="PIM3"
/gene_synonym="pim-3"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173623"
misc_feature order(1015..1035,1069..1080)
/gene="PIM3"
/gene_synonym="pim-3"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173623"
exon 539..648
/gene="PIM3"
/gene_synonym="pim-3"
/inference="alignment:Splign:1.39.8"
variation 549
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="g"
/db_xref="dbSNP:201604409"
variation 585
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="c"
/db_xref="dbSNP:11541025"
variation 597
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:368338754"
variation 623
/gene="PIM3"
/gene_synonym="pim-3"
/replace="g"
/replace="t"
/db_xref="dbSNP:200133533"
variation 639
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:370974207"
exon 649..699
/gene="PIM3"
/gene_synonym="pim-3"
/inference="alignment:Splign:1.39.8"
exon 700..1069
/gene="PIM3"
/gene_synonym="pim-3"
/inference="alignment:Splign:1.39.8"
variation 804
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:377715114"
variation 880
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="g"
/db_xref="dbSNP:4074581"
variation 918
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:371740020"
variation 1017
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:200802052"
variation 1023
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:146220002"
variation 1029
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="g"
/db_xref="dbSNP:139268901"
variation 1048
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:369036198"
exon 1070..1246
/gene="PIM3"
/gene_synonym="pim-3"
/inference="alignment:Splign:1.39.8"
variation 1074
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:370641817"
variation 1101
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:144102095"
variation 1110
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:200797950"
variation 1119
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:144759588"
variation 1134
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:56188169"
variation 1161
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:139618660"
variation 1165
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="t"
/db_xref="dbSNP:149755625"
variation 1168
/gene="PIM3"
/gene_synonym="pim-3"
/replace="g"
/replace="t"
/db_xref="dbSNP:145700427"
variation 1198
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="g"
/db_xref="dbSNP:148936816"
variation 1206
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:139983531"
variation 1221
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:147698351"
variation 1228
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:142498730"
variation 1230
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:118127603"
variation 1236
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:201620023"
variation 1239
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="g"
/db_xref="dbSNP:201559644"
variation 1244
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:377375610"
exon 1247..2379
/gene="PIM3"
/gene_synonym="pim-3"
/inference="alignment:Splign:1.39.8"
variation 1269
/gene="PIM3"
/gene_synonym="pim-3"
/replace="g"
/replace="t"
/db_xref="dbSNP:369976635"
variation 1287
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:15682"
variation 1317
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:200601202"
variation 1352
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:4077129"
variation 1355
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:373626258"
variation 1378
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="c"
/db_xref="dbSNP:76212103"
variation 1390
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:138365598"
variation 1398
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:141546677"
variation 1412
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:146200805"
variation 1416
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:111539054"
variation 1449
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:376831327"
variation 1470
/gene="PIM3"
/gene_synonym="pim-3"
/replace="g"
/replace="t"
/db_xref="dbSNP:201470457"
variation 1476
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:369326813"
variation 1491
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:185984395"
variation 1509
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:1801645"
variation 1523
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:191945241"
variation 1534
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:182810778"
variation 1546
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:188247486"
variation 1620
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:147722938"
variation 1624
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:114320081"
variation 1653
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:192783206"
variation 1928
/gene="PIM3"
/gene_synonym="pim-3"
/replace="g"
/replace="t"
/db_xref="dbSNP:375856544"
variation 1964
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:114867023"
variation 1976
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:376201119"
variation 1980
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="t"
/db_xref="dbSNP:182147507"
variation 2009
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:186743459"
variation 2019
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="c"
/db_xref="dbSNP:11541019"
variation 2067
/gene="PIM3"
/gene_synonym="pim-3"
/replace="g"
/replace="t"
/db_xref="dbSNP:369513773"
variation 2075
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:13811"
STS 2081..2208
/gene="PIM3"
/gene_synonym="pim-3"
/standard_name="RH78485"
/db_xref="UniSTS:12085"
variation 2157
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="g"
/db_xref="dbSNP:192375647"
variation 2191
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="t"
/db_xref="dbSNP:184757057"
STS 2225..2329
/gene="PIM3"
/gene_synonym="pim-3"
/standard_name="WI-11798"
/db_xref="UniSTS:30052"
variation 2236
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:142470900"
variation 2284
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:117325373"
variation 2290
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:376791318"
variation 2316
/gene="PIM3"
/gene_synonym="pim-3"
/replace="a"
/replace="g"
/db_xref="dbSNP:150927168"
variation 2326
/gene="PIM3"
/gene_synonym="pim-3"
/replace="c"
/replace="g"
/db_xref="dbSNP:189822817"
ORIGIN
gagagcgtgagcgcggagagcggaccgacgcgacacgccgtgcgcctccgcggctgcgctacgaaaacgagtcccggagcggccccgcgcccgccgcacccggccctcgcccgcccgaagacaggcgccaagctgccccgccgtctccccagctagcgcccggccgccgccgcctcgcgggccccgggcggaagggggcggggtcccgattcgccccgcccccgcggagggatacgcggcgccgcggcccaaaacccccgggcgaggcggccggggcgggtgaggcgctccgcctgctgcgcgtctacgcggtccccgcgggccttccgggcccactgcgccgcgcggaccgcctcgggctcggacggccggtgtccccggcgcgccgctcgcccggatcggccgcggcttcggcgcctggggctcggggctccggggaggccgtcgcccgcgatgctgctctccaagttcggctccctggcgcacctctgcgggcccggcggcgtggaccacctcccggtgaagatcctgcagccagccaaggcggacaaggagagcttcgagaaggcgtaccaggtgggcgccgtgctgggtagcggcggcttcggcacggtctacgcgggtagccgcatcgccgacgggctcccggtggctgtgaagcacgtggtgaaggagcgggtgaccgagtggggcagcctgggcggcgcgaccgtgcccctggaggtggtgctgctgcgcaaggtgggcgcggcgggcggcgcgcgcggcgtcatccgcctgctggactggttcgagcggcccgacggcttcctgctggtgctggagcggcccgagccggcgcaggacctcttcgactttatcacggagcgcggcgccctggacgagccgctggcgcgccgcttcttcgcgcaggtgctggccgccgtgcgccactgccacagctgcggggtcgtgcaccgcgacattaaggacgaaaatctgcttgtggacctgcgctccggagagctcaagctcatcgacttcggttcgggtgcgctgctcaaggacacggtctacaccgacttcgacggcacccgagtgtacagccccccggagtggatccgctaccaccgctaccacgggcgctcggccaccgtgtggtcgctgggcgtgcttctctacgatatggtgtgtggggacatccccttcgagcaggacgaggagatcctccgaggccgcctgctcttccggaggagggtctctccagagtgccagcagctgatccggtggtgcctgtccctgcggccctcagagcggccgtcgctggatcagattgcggcccatccctggatgctgggggctgacgggggcgtcccggagagctgtgacctgcggctgtgcaccctcgaccctgatgacgtggccagcaccacgtccagcagcgagagcttgtgaggagctgcacctgactgggagctaggggaccacctgccttggccagacctgggacgcccccagaccctgactttctcctgcgtgggccgtctcctcctgcggaagcagtgacctctgacccctggtgaccttcgctttgagtgccttttgaacgctggtcccgcgggacttggttttctcaagctctgtctgtccaaagacgctccggtcgaggtcccgcctgccctgggtggatacttgaaccccagacgcccctctgtgctgctgtgtccggaggcggccttcccatctgcctgcccacccggagctctttccgccggcgcagggtcccaagcccacctcccgccctcagtcctgcggtgtgcgtctgggcacgtcctgcacacacaatgcaagtcctggcctccgcgcccgcccgcccacgcgagccgtacccgccgccaactctgttatttatggtgtgaccccctggaggtgccctcggcccaccggggctatttattgtttaatttatttgttgaggttatttcctctgagcagtctgcctctcccaagccccaggggacagtggggaggcaggggagggggtggctgtggtccagggaccccaggccctgattcctgtgcctggcgtctgtcccggccccgcctgtcagaagatgaacatgtatagtggctaacttaaggggagtgggtgaccctgacacttccaggcactgtgcccagggtttgggttttaaattattgactttgtacagtctgcttgtgggctctgaaagctggggtggggccagagcctgagcgtttaatttattcagtacctgtgtttgtgtgaatgcggtgtgtgcaggcatcgcagatgggggttctttcagttcaaaagtgagatgtctggagatcatatttttttatacaggtatttcaattaaaatgtttttgtacataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:415116 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA
GeneID:415116 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:415116 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:415116 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:415116 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:415116 -> Biological process: GO:0007049 [cell cycle] evidence: IEA
GeneID:415116 -> Biological process: GO:0007346 [regulation of mitotic cell cycle] evidence: IMP
GeneID:415116 -> Biological process: GO:0016572 [histone phosphorylation] evidence: IEA
GeneID:415116 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IMP
GeneID:415116 -> Biological process: GO:0046777 [protein autophosphorylation] evidence: IEA
GeneID:415116 -> Biological process: GO:0061179 [negative regulation of insulin secretion involved in cellular response to glucose stimulus] evidence: ISS
GeneID:415116 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001001852 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.