GGRNA Home | Help | Advanced search

2024-03-28 17:14:23, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_000769               1473 bp    mRNA    linear   PRI 15-JUL-2013
DEFINITION  Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 19
            (CYP2C19), mRNA.
ACCESSION   NM_000769
VERSION     NM_000769.1  GI:4503218
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1473)
  AUTHORS   Grosdidier,C., Quilici,J., Loosveld,M., Camoin,L., Moro,P.J.,
            Saut,N., Gaborit,B., Pankert,M., Cohen,W., Lambert,M., Beguin,S.,
            Morange,P.E., Bonnet,J.L., Alessi,M.C. and Cuisset,T.
  TITLE     Effect of CYP2C19*2 and *17 genetic variants on platelet response
            to clopidogrel and prasugrel maintenance dose and relation to
            bleeding complications
  JOURNAL   Am. J. Cardiol. 111 (7), 985-990 (2013)
   PUBMED   23340030
  REMARK    GeneRIF: In acute coronary syndrome, clopidogrel and prasugrel have
            genetic modulation by CYP2C19 *2 and *17 alleles and prasugrel
            provides greater platelet inhibition, regardless of genotypes. LTPR
            was associated with a greater risk of bleeding.
REFERENCE   2  (bases 1 to 1473)
  AUTHORS   Yang,J., Zhao,H.D., Tan,J., Ding,Y.L., Gu,Z.Q. and Zou,J.J.
  TITLE     CYP2C19 polymorphism and antiplatelet effects of clopidogrel in
            Chinese stroke patients
  JOURNAL   Pharmazie 68 (3), 183-186 (2013)
   PUBMED   23556336
  REMARK    GeneRIF: In those patients who were carriers of 1 mutant allele
            (mutant heterozygotes, CYP2C19*1/*2 or *1/*3), ADP-induced maximum
            platelet aggregation were significantly different compared with
            wild-type homozygous patients
REFERENCE   3  (bases 1 to 1473)
  AUTHORS   Musumba,C.O., Jorgensen,A., Sutton,L., Van Eker,D., Zhang,E.,
            O'Hara,N., Carr,D.F., Pritchard,D.M. and Pirmohamed,M.
  TITLE     CYP2C19*17 gain-of-function polymorphism is associated with peptic
            ulcer disease
  JOURNAL   Clin. Pharmacol. Ther. 93 (2), 195-203 (2013)
   PUBMED   23267857
  REMARK    GeneRIF: CYP2C19*17, a gain-of-function polymorphism, is associated
            with PUD irrespective of etiology.
REFERENCE   4  (bases 1 to 1473)
  AUTHORS   Peng,H.M. and Auchus,R.J.
  TITLE     The action of cytochrome b(5) on CYP2E1 and CYP2C19 activities
            requires anionic residues D58 and D65
  JOURNAL   Biochemistry 52 (1), 210-220 (2013)
   PUBMED   23193974
  REMARK    GeneRIF: Cytochrome b(5) residues D58 and D65 are essential for the
            stimulation of CYP2E1 and CYP2C19 activities and that the
            phospholipid composition significantly influences the b(5)-P450
            interaction.
REFERENCE   5  (bases 1 to 1473)
  AUTHORS   Sanford,J.C., Guo,Y., Sadee,W. and Wang,D.
  TITLE     Regulatory polymorphisms in CYP2C19 affecting hepatic expression
  JOURNAL   Drug Metabol Drug Interact 28 (1), 23-30 (2013)
   PUBMED   23412869
  REMARK    GeneRIF: Our findings confirm *17 as a regulatory polymorphism
            enhancing hepatic CYP2C19 expression 2-fold with potential to
            compensate for the loss of function allele CYP2C19*2
REFERENCE   6  (bases 1 to 1473)
  AUTHORS   Nelson,D.R., Zeldin,D.C., Hoffman,S.M., Maltais,L.J., Wain,H.M. and
            Nebert,D.W.
  TITLE     Comparison of cytochrome P450 (CYP) genes from the mouse and human
            genomes, including nomenclature recommendations for genes,
            pseudogenes and alternative-splice variants
  JOURNAL   Pharmacogenetics 14 (1), 1-18 (2004)
   PUBMED   15128046
  REMARK    Review article
REFERENCE   7  (bases 1 to 1473)
  AUTHORS   Goldstein,J.A. and de Morais,S.M.
  TITLE     Biochemistry and molecular biology of the human CYP2C subfamily
  JOURNAL   Pharmacogenetics 4 (6), 285-299 (1994)
   PUBMED   7704034
  REMARK    Review article
REFERENCE   8  (bases 1 to 1473)
  AUTHORS   De Morais,S.M., Wilkinson,G.R., Blaisdell,J., Meyer,U.A.,
            Nakamura,K. and Goldstein,J.A.
  TITLE     Identification of a new genetic defect responsible for the
            polymorphism of (S)-mephenytoin metabolism in Japanese
  JOURNAL   Mol. Pharmacol. 46 (4), 594-598 (1994)
   PUBMED   7969038
REFERENCE   9  (bases 1 to 1473)
  AUTHORS   Romkes,M., Faletto,M.B., Blaisdell,J.A., Raucy,J.L. and
            Goldstein,J.A.
  TITLE     Cloning and expression of complementary DNAs for multiple members
            of the human cytochrome P450IIC subfamily
  JOURNAL   Biochemistry 30 (13), 3247-3255 (1991)
   PUBMED   2009263
  REMARK    Erratum:[Biochemistry. 1993 Feb 9;32(5):1390. PMID: 8095407]
REFERENCE   10 (bases 1 to 1473)
  AUTHORS   Meier,U.T. and Meyer,U.A.
  TITLE     Genetic polymorphism of human cytochrome P-450 (S)-mephenytoin
            4-hydroxylase. Studies with human autoantibodies suggest a
            functionally altered cytochrome P-450 isozyme as cause of the
            genetic deficiency
  JOURNAL   Biochemistry 26 (25), 8466-8474 (1987)
   PUBMED   3442670
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from M61854.1.
            This sequence is a reference standard in the RefSeqGene project.
            
            Summary: This gene encodes a member of the cytochrome P450
            superfamily of enzymes. The cytochrome P450 proteins are
            monooxygenases which catalyze many reactions involved in drug
            metabolism and synthesis of cholesterol, steroids and other lipids.
            This protein localizes to the endoplasmic reticulum and is known to
            metabolize many xenobiotics, including the anticonvulsive drug
            mephenytoin, omeprazole, diazepam and some barbiturates.
            Polymorphism within this gene is associated with variable ability
            to metabolize mephenytoin, known as the poor metabolizer and
            extensive metabolizer phenotypes. The gene is located within a
            cluster of cytochrome P450 genes on chromosome 10q24. [provided by
            RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: M61854.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1473
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q24"
     gene            1..1473
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /note="cytochrome P450, family 2, subfamily C, polypeptide
                     19"
                     /db_xref="GeneID:1557"
                     /db_xref="HGNC:2621"
                     /db_xref="HPRD:00486"
                     /db_xref="MIM:124020"
     CDS             1..1473
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /EC_number="1.14.13.48"
                     /EC_number="1.14.13.49"
                     /EC_number="1.14.13.80"
                     /note="microsomal monooxygenase; xenobiotic monooxygenase;
                     flavoprotein-linked monooxygenase; cytochrome P450,
                     subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19;
                     mephenytoin 4'-hydroxylase; cytochrome P450 2C19;
                     S-mephenytoin 4-hydroxylase; cytochrome P-450 II C;
                     CYPIIC17; CYPIIC19; cytochrome P450-11A; cytochrome
                     P450-254C; (R)-limonene 6-monooxygenase; (S)-limonene
                     6-monooxygenase; (S)-limonene 7-monooxygenase"
                     /codon_start=1
                     /product="cytochrome P450 2C19 precursor"
                     /protein_id="NP_000760.1"
                     /db_xref="GI:4503219"
                     /db_xref="CCDS:CCDS7436.1"
                     /db_xref="GeneID:1557"
                     /db_xref="HGNC:2621"
                     /db_xref="HPRD:00486"
                     /db_xref="MIM:124020"
                     /translation="
MDPFVVLVLCLSCLLLLSIWRQSSGRGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV
"
     sig_peptide     1..75
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    88..1461
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /note="Cytochrome P450; Region: p450; pfam00067"
                     /db_xref="CDD:200971"
     misc_feature    91..1410
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /note="Cytochrome P450 [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: CypX;
                     cl12078"
                     /db_xref="CDD:212625"
     misc_feature    1303..1305
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /note="heme binding site"
     STS             1..1473
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /db_xref="UniSTS:481123"
     exon            1..168
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="alignment:Splign:1.39.8"
     variation       1
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28399504"
     variation       4
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377381376"
     variation       7
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367543002"
     variation       10
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367543003"
     variation       22
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:141890453"
     variation       28
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200381600"
     STS             30..167
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /standard_name="GDB:193845"
                     /db_xref="UniSTS:155761"
     variation       46
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147255955"
     variation       50
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:55752064"
     variation       55
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17882687"
     variation       65
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144928727"
     variation       72
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147949502"
     variation       99
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17885098"
     exon            169..331
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="alignment:Splign:1.39.8"
     variation       190
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150045105"
     variation       193
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202036394"
     variation       217
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145328984"
     variation       218
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201306972"
     variation       221
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:28399505"
     variation       241
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149072229"
     variation       265
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143075956"
     variation       271
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:118203756"
     variation       276
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:17878459"
     variation       292
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375159521"
     variation       305
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372985779"
     variation       326
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200347843"
     variation       329
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:112197069"
     exon            332..481
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="alignment:Splign:1.39.8"
     variation       335
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372875966"
     variation       336
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201723068"
     variation       337
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145119820"
     variation       358
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41291556"
     variation       365
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17885179"
     variation       370
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202170044"
     variation       371
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200346442"
     variation       373
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200150287"
     variation       374
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141774245"
     variation       389
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150152656"
     variation       390
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:17882291"
     variation       392
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371309036"
     variation       394
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149590953"
     variation       395
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:72552267"
     variation       409
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374950950"
     variation       417
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140736981"
     variation       430
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368767518"
     variation       431
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17884712"
     variation       439
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371603566"
     variation       440
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147453531"
     variation       442
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148593307"
     variation       448
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142974781"
     variation       449
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:58973490"
     variation       463
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374036992"
     variation       478
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375760063"
     variation       481
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:181297724"
     exon            482..642
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="alignment:Splign:1.39.8"
     variation       502
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:28399510"
     variation       518
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61311738"
     variation       527
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:57700608"
     variation       556
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183701923"
     variation       557
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140278421"
     variation       562
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370803989"
     variation       566
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373613403"
     variation       570
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369901889"
     variation       593
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186489608"
     STS             600..883
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /standard_name="GDB:364113"
                     /db_xref="UniSTS:156806"
     variation       636
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4986893"
     exon            643..819
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="alignment:Splign:1.39.8"
     variation       676
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200362177"
     variation       680
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6413438"
     variation       681
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:4244285"
     variation       721..722
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:72558185"
     variation       753
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148247410"
     variation       766
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375781227"
     variation       798
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140267616"
     variation       801
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377674118"
     exon            820..961
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="alignment:Splign:1.39.8"
     variation       834
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145232070"
     variation       836
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:61526399"
     variation       839
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:58744432"
     variation       848
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201391010"
     variation       853
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141533135"
     variation       865
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371913046"
     variation       894
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200717347"
     variation       896
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199597498"
     variation       903
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17879239"
     variation       905
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:58259047"
     exon            962..1149
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="alignment:Splign:1.39.8"
     variation       985
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:59734894"
     variation       986
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138142612"
     variation       990
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3758580"
     variation       991
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3758581"
     variation       993
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:58068888"
     variation       1003
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368758960"
     variation       1004
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:118203757"
     variation       1007
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143833145"
     variation       1014
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370320936"
     variation       1016
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146357635"
     variation       1030
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:55681001"
     variation       1034
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201132803"
     variation       1048
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201509150"
     variation       1058
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373024844"
     variation       1059
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17882744"
     variation       1062
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56401472"
     variation       1067
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371241592"
     variation       1076
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:374493781"
     variation       1077
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370051475"
     variation       1078
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144036596"
     variation       1107
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201511483"
     variation       1119
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150933530"
     variation       1120
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113934938"
     exon            1150..1291
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="alignment:Splign:1.39.8"
     variation       1150
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:188851578"
     variation       1159
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372873637"
     variation       1180
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55948420"
     variation       1197
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377184510"
     variation       1216
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144056033"
     variation       1228
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17879685"
     variation       1229
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367674480"
     variation       1251
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17886522"
     variation       1262
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145599727"
     variation       1288
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369403039"
     exon            1292..1473
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /inference="alignment:Splign:1.39.8"
     variation       1295
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:146991374"
     variation       1297
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56337013"
     variation       1316
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:5787121"
     variation       1320
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202150773"
     variation       1324
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192154563"
     variation       1325
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138112316"
     variation       1344
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:118203759"
     variation       1349
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:141690375"
     variation       1351
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:376426772"
     variation       1352
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369665827"
     variation       1381
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147052245"
     variation       1386
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200174624"
     variation       1390
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:58519063"
     variation       1396
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201302485"
     variation       1398
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375283723"
     variation       1440
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28399514"
     variation       1473
                     /gene="CYP2C19"
                     /gene_synonym="CPCJ; CYP2C; P450C2C; P450IIC19"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:55640102"
ORIGIN      
atggatccttttgtggtccttgtgctctgtctctcatgtttgcttctcctttcaatctggagacagagctctgggagaggaaaactccctcctggccccactcctctcccagtgattggaaatatcctacagatagatattaaggatgtcagcaaatccttaaccaatctctcaaaaatctatggccctgtgttcactctgtattttggcctggaacgcatggtggtgctgcatggatatgaagtggtgaaggaagccctgattgatcttggagaggagttttctggaagaggccatttcccactggctgaaagagctaacagaggatttggaatcgttttcagcaatggaaagagatggaaggagatccggcgtttctccctcatgacgctgcggaattttgggatggggaagaggagcattgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaaggcttcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctccattattttccagaaacgtttcgattataaagatcagcaatttcttaacttgatggaaaaattgaatgaaaacatcaggattgtaagcaccccctggatccagatatgcaataattttcccactatcattgattatttcccgggaacccataacaaattacttaaaaaccttgcttttatggaaagtgatattttggagaaagtaaaagaacaccaagaatcgatggacatcaacaaccctcgggactttattgattgcttcctgatcaaaatggagaaggaaaagcaaaaccaacagtctgaattcactattgaaaacttggtaatcactgcagctgacttacttggagctgggacagagacaacaagcacaaccctgagatatgctctccttctcctgctgaagcacccagaggtcacagctaaagtccaggaagagattgaacgtgtcattggcagaaaccggagcccctgcatgcaggacaggggccacatgccctacacagatgctgtggtgcacgaggtccagagatacatcgacctcatccccaccagcctgccccatgcagtgacctgtgacgttaaattcagaaactacctcattcccaagggcacaaccatattaacttccctcacttctgtgctacatgacaacaaagaatttcccaacccagagatgtttgaccctcgtcactttctggatgaaggtggaaattttaagaaaagtaactacttcatgcctttctcagcaggaaaacggatttgtgtgggagagggcctggcccgcatggagctgtttttattcctgaccttcattttacagaactttaacctgaaatctctgattgacccaaaggaccttgacacaactcctgttgtcaatggatttgcttctgtcccgcccttctatcagctgtgcttcattcctgtctga
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1557 -> Molecular function: GO:0004497 [monooxygenase activity] evidence: IDA
            GeneID:1557 -> Molecular function: GO:0005506 [iron ion binding] evidence: IEA
            GeneID:1557 -> Molecular function: GO:0008395 [steroid hydroxylase activity] evidence: IMP
            GeneID:1557 -> Molecular function: GO:0009055 [electron carrier activity] evidence: IEA
            GeneID:1557 -> Molecular function: GO:0016491 [oxidoreductase activity] evidence: IDA
            GeneID:1557 -> Molecular function: GO:0018675 [(S)-limonene 6-monooxygenase activity] evidence: IEA
            GeneID:1557 -> Molecular function: GO:0018676 [(S)-limonene 7-monooxygenase activity] evidence: IEA
            GeneID:1557 -> Molecular function: GO:0019825 [oxygen binding] evidence: TAS
            GeneID:1557 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI
            GeneID:1557 -> Molecular function: GO:0020037 [heme binding] evidence: IDA
            GeneID:1557 -> Molecular function: GO:0052741 [(R)-limonene 6-monooxygenase activity] evidence: IEA
            GeneID:1557 -> Biological process: GO:0006805 [xenobiotic metabolic process] evidence: TAS
            GeneID:1557 -> Biological process: GO:0008202 [steroid metabolic process] evidence: IMP
            GeneID:1557 -> Biological process: GO:0016098 [monoterpenoid metabolic process] evidence: IDA
            GeneID:1557 -> Biological process: GO:0017144 [drug metabolic process] evidence: IDA
            GeneID:1557 -> Biological process: GO:0019369 [arachidonic acid metabolic process] evidence: TAS
            GeneID:1557 -> Biological process: GO:0019373 [epoxygenase P450 pathway] evidence: TAS
            GeneID:1557 -> Biological process: GO:0042738 [exogenous drug catabolic process] evidence: IDA
            GeneID:1557 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
            GeneID:1557 -> Biological process: GO:0046483 [heterocycle metabolic process] evidence: IDA
            GeneID:1557 -> Biological process: GO:0055114 [oxidation-reduction process] evidence: IDA
            GeneID:1557 -> Biological process: GO:0097267 [omega-hydroxylase P450 pathway] evidence: TAS
            GeneID:1557 -> Cellular component: GO:0005789 [endoplasmic reticulum membrane] evidence: TAS
            GeneID:1557 -> Cellular component: GO:0043231 [intracellular membrane-bounded organelle] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_000760 -> EC 1.14.13.48
            NP_000760 -> EC 1.14.13.49
            NP_000760 -> EC 1.14.13.80

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.