Home |
Help |
Advanced search
2024-04-25 13:43:20, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000737 933 bp mRNA linear PRI 24-JUN-2013
DEFINITION Homo sapiens chorionic gonadotropin, beta polypeptide (CGB), mRNA.
ACCESSION NM_000737
VERSION NM_000737.3 GI:356874799
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 933)
AUTHORS Schumacher,A., Heinze,K., Witte,J., Poloski,E., Linzke,N.,
Woidacki,K. and Zenclussen,A.C.
TITLE Human chorionic gonadotropin as a central regulator of pregnancy
immune tolerance
JOURNAL J. Immunol. 190 (6), 2650-2658 (2013)
PUBMED 23396945
REMARK GeneRIF: Human CG not only acts as a chemoattractant of regulatory
T (Treg) cells but also plays a central role in pregnancy-induced
immune tolerance.
REFERENCE 2 (bases 1 to 933)
AUTHORS Turgut,E.N., Celik,E., Celik,S., Arikan,D.C., Altuntas,H.,
Leblebici,C., Purisa,S. and Dansuk,R.
TITLE Could serum beta-hCG levels and gestational age be the indicative
factors for the prediction of the degree of trophoblastic invasion
into tubal wall in unruptured ampullary pregnancies?
JOURNAL Arch. Gynecol. Obstet. 287 (2), 323-328 (2013)
PUBMED 23011731
REMARK GeneRIF: The depth of trophoblastic tissue infiltration into tubal
wall in ampullary pregnancies is correlated with serum beta-hCG
levels, but not with gestational age.
REFERENCE 3 (bases 1 to 933)
AUTHORS Nitta,S., Kawai,K., Onozawa,M., Ando,S., Miyazaki,J., Nagata,C.,
Noguchi,M., Yamasaki,K., Uchida,K., Iwamoto,T. and Nishiyama,H.
TITLE Intratubular trophoblasts in the contralateral testis caused
elevation of serum human chorionic gonadotropin following complete
remission of stage II testicular tumor: a case report
JOURNAL Jpn. J. Clin. Oncol. 43 (1), 83-86 (2013)
PUBMED 23136239
REMARK GeneRIF: Elevation of serum human chorionic gonadotropin is
associated with intratubular trophoblasts in the contralateral
testis.
REFERENCE 4 (bases 1 to 933)
AUTHORS Cocquebert,M., Berndt,S., Segond,N., Guibourdenche,J., Murthi,P.,
Aldaz-Carroll,L., Evain-Brion,D. and Fournier,T.
TITLE Comparative expression of hCG beta-genes in human trophoblast from
early and late first-trimester placentas
JOURNAL Am. J. Physiol. Endocrinol. Metab. 303 (8), E950-E958 (2012)
PUBMED 22811468
REMARK GeneRIF: we showed that type 1 and type 2 beta-hCG are highly
expressed by villous mononucleated cytotrophoblasts in the early
first trimester
REFERENCE 5 (bases 1 to 933)
AUTHORS Dukic-Stefanovic,S., Walther,J., Wosch,S., Zimmermann,G.,
Wiedemann,P., Alexander,H. and Claudepierre,T.
TITLE Chorionic gonadotropin and its receptor are both expressed in human
retina, possible implications in normal and pathological conditions
JOURNAL PLoS ONE 7 (12), E52567 (2012)
PUBMED 23285091
REMARK GeneRIF: A complex neuroendocrine circuit exists in the retina,
involving hCG secreting cells, hCG targets and hCG-release
controlling cells.
REFERENCE 6 (bases 1 to 933)
AUTHORS Rothman,P.A., Chao,V.A., Taylor,M.R., Kuhn,R.W., Jaffe,R.B. and
Taylor,R.N.
TITLE Extraplacental human fetal tissues express mRNA transcripts
encoding the human chorionic gonadotropin-beta subunit protein
JOURNAL Mol. Reprod. Dev. 33 (1), 1-6 (1992)
PUBMED 1510839
REFERENCE 7 (bases 1 to 933)
AUTHORS Maruo,T., Ladines-Llave,C.A., Matsuo,H., Manalo,A.S. and
Mochizuki,M.
TITLE A novel change in cytologic localization of human chorionic
gonadotropin and human placental lactogen in first-trimester
placenta in the course of gestation
JOURNAL Am. J. Obstet. Gynecol. 167 (1), 217-222 (1992)
PUBMED 1442929
REFERENCE 8 (bases 1 to 933)
AUTHORS Bo,M. and Boime,I.
TITLE Identification of the transcriptionally active genes of the
chorionic gonadotropin beta gene cluster in vivo
JOURNAL J. Biol. Chem. 267 (5), 3179-3184 (1992)
PUBMED 1371113
REFERENCE 9 (bases 1 to 933)
AUTHORS Weisshaar,G., Hiyama,J. and Renwick,A.G.
TITLE Site-specific N-glycosylation of human chorionic
gonadotrophin--structural analysis of glycopeptides by one- and
two-dimensional 1H NMR spectroscopy
JOURNAL Glycobiology 1 (4), 393-404 (1991)
PUBMED 1820200
REFERENCE 10 (bases 1 to 933)
AUTHORS Beebe,J.S., Mountjoy,K., Krzesicki,R.F., Perini,F. and Ruddon,R.W.
TITLE Role of disulfide bond formation in the folding of human chorionic
gonadotropin beta subunit into an alpha beta dimer
assembly-competent form
JOURNAL J. Biol. Chem. 265 (1), 312-317 (1990)
PUBMED 1688430
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BX334905.2, AK291552.1 and
BC106059.1.
On Nov 11, 2011 this sequence version replaced gi:15451751.
Summary: This gene is a member of the glycoprotein hormone beta
chain family and encodes the beta 3 subunit of chorionic
gonadotropin (CG). Glycoprotein hormones are heterodimers
consisting of a common alpha subunit and an unique beta subunit
which confers biological specificity. CG is produced by the
trophoblastic cells of the placenta and stimulates the ovaries to
synthesize the steroids that are essential for the maintenance of
pregnancy. The beta subunit of CG is encoded by 6 genes which are
arranged in tandem and inverted pairs on chromosome 19q13.3 and
contiguous with the luteinizing hormone beta subunit gene.
[provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BX334905.2, AK291552.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025085 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-42 BX334905.2 1-42
43-902 AK291552.1 1-860
903-933 BC106059.1 849-879
FEATURES Location/Qualifiers
source 1..933
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.32"
gene 1..933
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/note="chorionic gonadotropin, beta polypeptide"
/db_xref="GeneID:1082"
/db_xref="HGNC:1886"
/db_xref="HPRD:00343"
/db_xref="MIM:118860"
exon 1..419
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/inference="alignment:Splign:1.39.8"
variation complement(48)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:74174271"
variation complement(48)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:112003635"
variation complement(51)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="g"
/replace="t"
/db_xref="dbSNP:74174270"
variation complement(51)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="g"
/replace="t"
/db_xref="dbSNP:112682393"
variation complement(77)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:74174269"
variation complement(77)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:201091434"
variation complement(81)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:74174268"
variation complement(81)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:200207020"
variation complement(129)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:141557498"
variation complement(131)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:376973036"
variation complement(133)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:71352717"
variation complement(137)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="g"
/db_xref="dbSNP:369610551"
variation complement(162)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:112139593"
variation complement(196)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:375217929"
variation complement(220)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="g"
/db_xref="dbSNP:201985302"
variation complement(225)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:201181723"
variation complement(261)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="c"
/db_xref="dbSNP:76097816"
variation complement(261)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="g"
/replace="t"
/db_xref="dbSNP:34236386"
variation complement(294)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:72626227"
variation complement(294)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:74174265"
variation complement(294)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:34236037"
variation complement(316)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:368756847"
variation complement(328)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:62126028"
variation complement(328)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:74174264"
variation complement(359)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="c"
/db_xref="dbSNP:369725157"
variation complement(362)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:375631692"
variation complement(363)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:375297042"
variation complement(365)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:371959359"
variation complement(368)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="t"
/db_xref="dbSNP:200375640"
misc_feature 369..371
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/note="upstream in-frame stop codon"
variation complement(370)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:202072529"
variation complement(378)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:372316356"
variation complement(384)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="g"
/db_xref="dbSNP:201342765"
STS 396..913
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/db_xref="UniSTS:483811"
variation complement(396)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:200578663"
CDS 405..902
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/note="chorionic gonadotropin beta chain; chorionic
gonadotropin beta 3 subunit; choriogonadotropin subunit
beta; chorionic gonadotropin beta subunit; CG-beta;
chorionic gonadotrophin chain beta"
/codon_start=1
/product="choriogonadotropin subunit beta precursor"
/protein_id="NP_000728.1"
/db_xref="GI:4502789"
/db_xref="CCDS:CCDS12749.1"
/db_xref="GeneID:1082"
/db_xref="HGNC:1886"
/db_xref="HPRD:00343"
/db_xref="MIM:118860"
/translation="
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
"
sig_peptide 405..464
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 465..899
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/product="Choriogonadotropin subunit beta"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P01233.1)"
misc_feature 489..773
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/note="Glycoprotein hormone beta chain homologues; Region:
GHB_like; cd00069"
/db_xref="CDD:200450"
misc_feature order(489..491,564..566,576..578,633..635,726..728,
732..734)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/note="cysteine knot motif; other site"
/db_xref="CDD:200450"
misc_feature order(489..491,633..635)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature 501..503
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
/citation=[9]
misc_feature order(510..512,519..521,561..602,630..635,741..743,
747..749,756..773)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:200450"
misc_feature order(531..533,678..680)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature order(540..542,792..794)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature 552..554
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
/citation=[9]
misc_feature order(564..566,726..728)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature order(576..578,732..734)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature order(600..602,747..752,759..761,765..773)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/note="receptor binding site [polypeptide binding]; other
site"
/db_xref="CDD:200450"
misc_feature 660..662
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature order(741..743,762..764)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature 750..752
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 753..755
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
exon 420..587
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/inference="alignment:Splign:1.39.8"
variation complement(469)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:201575305"
variation complement(476)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:200749289"
variation complement(493)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:200012583"
variation complement(508)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:201780746"
variation complement(536)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="c"
/db_xref="dbSNP:200899514"
exon 588..919
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/inference="alignment:Splign:1.39.8"
STS 621..798
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/standard_name="RH71426"
/db_xref="UniSTS:32956"
STS 699..833
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/standard_name="D19S1130"
/db_xref="UniSTS:53128"
STS 783..917
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/standard_name="STS-J00117"
/db_xref="UniSTS:32231"
variation complement(814)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="c"
/db_xref="dbSNP:200199557"
variation complement(827)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="c"
/db_xref="dbSNP:139055053"
variation complement(840)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:141896729"
variation complement(841)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="g"
/db_xref="dbSNP:112003183"
variation complement(842)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="g"
/db_xref="dbSNP:17852109"
variation complement(854)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="t"
/db_xref="dbSNP:28571120"
variation complement(857)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="c"
/db_xref="dbSNP:199786416"
variation complement(877)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="c"
/db_xref="dbSNP:142522943"
variation complement(878)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:200571270"
variation complement(886)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="c"
/replace="g"
/db_xref="dbSNP:200570800"
polyA_signal 898..903
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
variation complement(899)
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
/replace="a"
/replace="g"
/db_xref="dbSNP:148118323"
polyA_site 919
/gene="CGB"
/gene_synonym="CGB3; CGB5; CGB7; CGB8; hCGB"
ORIGIN
tgcaggaaagcctcaagtagaggagggttgaggcttcagtccagcacctttctcgggtcacggcctcctcctggctcccaggaccccaccataggcagaggcaggccttcctacaccctactccctgtgcctccagcctcgactagtccctagcactcgacgactgagtctctgaggtcacttcaccgtggtctccgcctcacccttggcgctggaccagtgagaggagagggctggggcgctccgctgagccactcctgcgcccccctggccttgtctacctcttgccccccgaggggttagtgtcgagctcaccccagcatcctatcacctcctggtggccttgccgcccccacaaccccgaggtataaagccaggtacacgaggcaggggacgcaccaaggatggagatgttccaggggctgctgctgttgctgctgctgagcatgggcgggacatgggcatccaaggagccgcttcggccacggtgccgccccatcaatgccaccctggctgtggagaaggagggctgccccgtgtgcatcaccgtcaacaccaccatctgtgccggctactgccccaccatgacccgcgtgctgcagggggtcctgccggccctgcctcaggtggtgtgcaactaccgcgatgtgcgcttcgagtccatccggctccctggctgcccgcgcggcgtgaaccccgtggtctcctacgccgtggctctcagctgtcaatgtgcactctgccgccgcagcaccactgactgcgggggtcccaaggaccaccccttgacctgtgatgacccccgcttccaggactcctcttcctcaaaggcccctccccccagccttccaagcccatcccgactcccggggccctcggacaccccgatcctcccacaataaaggcttctcaatccgcaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:1082 -> Molecular function: GO:0005179 [hormone activity] evidence: IEA
GeneID:1082 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:1082 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:1082 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
GeneID:1082 -> Biological process: GO:0007292 [female gamete generation] evidence: TAS
GeneID:1082 -> Biological process: GO:0016486 [peptide hormone processing] evidence: TAS
GeneID:1082 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS
GeneID:1082 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.