Home |
Help |
Advanced search
2024-04-26 04:26:59, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000714 921 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens translocator protein (18kDa) (TSPO), transcript
variant PBR, mRNA.
ACCESSION NM_000714
VERSION NM_000714.5 GI:375065823
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 921)
AUTHORS Ko,J.H., Koshimori,Y., Mizrahi,R., Rusjan,P., Wilson,A.A.,
Lang,A.E., Houle,S. and Strafella,A.P.
TITLE Voxel-based imaging of translocator protein 18 kDa (TSPO) in
high-resolution PET
JOURNAL J. Cereb. Blood Flow Metab. 33 (3), 348-350 (2013)
PUBMED 23281426
REMARK GeneRIF: Voxel-based imaging of translocator protein 18 kDa (TSPO)
in high-resolution PET.
REFERENCE 2 (bases 1 to 921)
AUTHORS Kreisl WC, Jenko KJ, Hines CS, Lyoo CH, Corona W, Morse CL, Zoghbi
SS, Hyde T, Kleinman JE, Pike VW, McMahon FJ and Innis RB.
CONSRTM Biomarkers Consortium PET Radioligand Project Team
TITLE A genetic polymorphism for translocator protein 18 kDa affects both
in vitro and in vivo radioligand binding in human brain to this
putative biomarker of neuroinflammation
JOURNAL J. Cereb. Blood Flow Metab. 33 (1), 53-58 (2013)
PUBMED 22968319
REMARK GeneRIF: TSPO genotype influences PBR28 binding in vitro and in
vivo.
REFERENCE 3 (bases 1 to 921)
AUTHORS Gyrylova,S.N., Ruksha,T.G. and Komina,A.V.
TITLE [TSPO ligand PK11195 and MAPK inhibitor UO126 modulate tspo
expression level]
JOURNAL Tsitologiia 55 (2), 131-135 (2013)
PUBMED 23718075
REMARK GeneRIF: These data are crucial for indentifying of regulatory
processes for TSPO expression. Pathogenetic interconnection between
MAPK signaling partway and TSPO is important for novel therapeutic
approaches in melanoma treatment.
REFERENCE 4 (bases 1 to 921)
AUTHORS Ruksha,T., Aksenenko,M. and Papadopoulos,V.
TITLE Role of translocator protein in melanoma growth and progression
JOURNAL Arch. Dermatol. Res. 304 (10), 839-845 (2012)
PUBMED 23080515
REMARK GeneRIF: role in melanoma growth and progression
REFERENCE 5 (bases 1 to 921)
AUTHORS Yasuno,F., Kosaka,J., Ota,M., Higuchi,M., Ito,H., Fujimura,Y.,
Nozaki,S., Takahashi,S., Mizukami,K., Asada,T. and Suhara,T.
TITLE Increased binding of peripheral benzodiazepine receptor in mild
cognitive impairment-dementia converters measured by positron
emission tomography with [(1)(1)C]DAA1106
JOURNAL Psychiatry Res 203 (1), 67-74 (2012)
PUBMED 22892349
REMARK GeneRIF: Peripheral benzodiazepine receptor (PBR) binding, shown to
reflect activated microglia, was greater in patients with mild
cognitive impairment. MCI patients with PBR values higher than the
control mean +0.5 S.D. developed dementia within 5 years.
REFERENCE 6 (bases 1 to 921)
AUTHORS Yakovlev,A.G., Ruffo,M., Jurka,J. and Krueger,K.E.
TITLE Comparison of repetitive elements in the third intron of human and
rodent mitochondrial benzodiazepine receptor-encoding genes
JOURNAL Gene 155 (2), 201-205 (1995)
PUBMED 7721091
REFERENCE 7 (bases 1 to 921)
AUTHORS Chang,Y.J., McCabe,R.T., Rennert,H., Budarf,M.L., Sayegh,R.,
Emanuel,B.S., Skolnick,P. and Strauss,J.F. III.
TITLE The human 'peripheral-type' benzodiazepine receptor: regional
mapping of the gene and characterization of the receptor expressed
from cDNA
JOURNAL DNA Cell Biol. 11 (6), 471-480 (1992)
PUBMED 1326278
REFERENCE 8 (bases 1 to 921)
AUTHORS Riond,J., Mattei,M.G., Kaghad,M., Dumont,X., Guillemot,J.C., Le
Fur,G., Caput,D. and Ferrara,P.
TITLE Molecular cloning and chromosomal localization of a human
peripheral-type benzodiazepine receptor
JOURNAL Eur. J. Biochem. 195 (2), 305-311 (1991)
PUBMED 1847678
REFERENCE 9 (bases 1 to 921)
AUTHORS Awad,M. and Gavish,M.
TITLE Peripheral-type benzodiazepine receptors in human cerebral cortex,
kidney, and colon
JOURNAL Life Sci. 49 (16), 1155-1161 (1991)
PUBMED 1654492
REFERENCE 10 (bases 1 to 921)
AUTHORS Sieghart,W., Eichinger,A., Riederer,P. and Jellinger,K.
TITLE Comparison of benzodiazepine receptor binding in membranes from
human or rat brain
JOURNAL Neuropharmacology 24 (8), 751-759 (1985)
PUBMED 3018615
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BG752086.1, BP420304.1,
AF075589.1 and BC001110.2.
On Feb 9, 2012 this sequence version replaced gi:74275349.
Summary: Present mainly in the mitochondrial compartment of
peripheral tissues, the protein encoded by this gene interacts with
some benzodiazepines and has different affinities than its
endogenous counterpart. The protein is a key factor in the flow of
cholesterol into mitochondria to permit the initiation of steroid
hormone synthesis. Alternatively spliced transcript variants have
been reported; one of the variants lacks an internal exon and is
considered non-coding, and the other variants encode the same
protein. [provided by RefSeq, Feb 2012].
Transcript Variant: This variant (PBR) consists of four exons and
encodes the protein PBR.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC001110.2, BM554665.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-24 BG752086.1 1-24
25-530 BP420304.1 5-510
531-849 AF075589.1 334-652
850-921 BC001110.2 800-871
FEATURES Location/Qualifiers
source 1..921
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="22"
/map="22q13.31"
gene 1..921
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/note="translocator protein (18kDa)"
/db_xref="GeneID:706"
/db_xref="HGNC:1158"
/db_xref="MIM:109610"
exon 1..91
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/inference="alignment:Splign:1.39.8"
exon 92..302
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/inference="alignment:Splign:1.39.8"
misc_feature 100..102
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/note="upstream in-frame stop codon"
CDS 121..630
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/note="mitochondrial benzodiazepine receptor;
peripheral-type benzodiazepine receptor; benzodiazepine
peripheral binding site"
/codon_start=1
/product="translocator protein"
/protein_id="NP_000705.2"
/db_xref="GI:74275350"
/db_xref="CCDS:CCDS33661.1"
/db_xref="GeneID:706"
/db_xref="HGNC:1158"
/db_xref="MIM:109610"
/translation="
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
"
misc_feature 136..198
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P30536.3);
transmembrane region"
misc_feature 145..588
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/note="TspO/MBR family; Region: TspO_MBR; pfam03073"
/db_xref="CDD:202527"
misc_feature 259..321
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P30536.3);
transmembrane region"
misc_feature 358..420
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P30536.3);
transmembrane region"
misc_feature 436..498
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P30536.3);
transmembrane region"
misc_feature 523..585
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P30536.3);
transmembrane region"
variation 161
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:187866832"
variation 162
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="g"
/db_xref="dbSNP:372615034"
variation 204
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="c"
/db_xref="dbSNP:376383649"
variation 213
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:9333332"
variation 225
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:375039721"
variation 285
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="g"
/db_xref="dbSNP:192201237"
exon 303..441
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/inference="alignment:Splign:1.39.8"
variation 308
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="g"
/db_xref="dbSNP:139234976"
variation 330
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="g"
/db_xref="dbSNP:199899658"
variation 353
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:372235648"
variation 375
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:377098874"
variation 384
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="g"
/db_xref="dbSNP:376234950"
variation 401
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:142445069"
variation 427
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:368891259"
variation 437
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="g"
/replace="t"
/db_xref="dbSNP:143915407"
exon 442..881
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/inference="alignment:Splign:1.39.8"
variation 476
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:148614502"
variation 478
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="g"
/db_xref="dbSNP:200880548"
variation 512
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:373738253"
variation 531
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="g"
/db_xref="dbSNP:9333341"
variation 543
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="g"
/db_xref="dbSNP:142042960"
variation 559
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:6971"
variation 560
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:141002863"
variation 587
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="g"
/db_xref="dbSNP:375211541"
variation 604..605
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="g"
/db_xref="dbSNP:41371752"
variation 605
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="g"
/db_xref="dbSNP:6972"
STS 615..845
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/standard_name="RH27789"
/db_xref="UniSTS:89089"
variation 617
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="g"
/replace="t"
/db_xref="dbSNP:8192467"
variation 625
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="g"
/db_xref="dbSNP:9333342"
variation 632
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="g"
/replace="t"
/db_xref="dbSNP:8192468"
variation 650
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:372430939"
variation 689
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="a"
/replace="g"
/db_xref="dbSNP:79307767"
variation 700
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:150429499"
variation 717
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="g"
/db_xref="dbSNP:377258040"
variation 770
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="g"
/replace="t"
/db_xref="dbSNP:6973"
variation 785
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="g"
/db_xref="dbSNP:373324032"
variation 791
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="c"
/replace="t"
/db_xref="dbSNP:112069650"
polyA_signal 859..864
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
variation 866
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
/replace="g"
/replace="t"
/db_xref="dbSNP:111607654"
polyA_site 881
/gene="TSPO"
/gene_synonym="BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS;
pk18; PKBS; PTBR"
ORIGIN
ggcggctgggaggggcggggcggatgcggggacagcggcctggctaactcctgccaggcagtgcccttcccggagcgtgccctcgccgctgagctcccctgaacagcagctgcagcagccatggccccgccctgggtgcccgccatgggcttcacgctggcgcccagcctggggtgcttcgtgggctcccgctttgtccacggcgagggtctccgctggtacgccggcctgcagaagccctcgtggcacccgccccactgggtgctgggccctgtctggggcacgctctactcagccatggggtacggctcctacctggtctggaaagagctgggaggcttcacagagaaggctgtggttcccctgggcctctacactgggcagctggccctgaactgggcatggccccccatcttctttggtgcccgacaaatgggctgggccttggtggatctcctgctggtcagtggggcggcggcagccactaccgtggcctggtaccaggtgagcccgctggccgcccgcctgctctacccctacctggcctggctggccttcacgaccacactcaactactgcgtatggcgggacaaccatggctggcgtgggggacggcggctgccagagtgagtgcccggcccaccagggactgcagctgcaccagcaggtgccatcacgcttgtgatgtggtggccgtcacgctttcatgaccactgggcctgctagtctgtcagggccttggcccaggggtcagcagagcttcagaggtggccccacctgagcccccacccgggagcagtgtcctgtgctttctgcatgcttagagcatgttcttggaacatggaattttataagctgaataaagtttttgacttcctttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:706 -> Molecular function: GO:0005497 [androgen binding] evidence: IEA
GeneID:706 -> Molecular function: GO:0008503 [benzodiazepine receptor activity] evidence: IEA
GeneID:706 -> Molecular function: GO:0015485 [cholesterol binding] evidence: TAS
GeneID:706 -> Biological process: GO:0006626 [protein targeting to mitochondrion] evidence: TAS
GeneID:706 -> Biological process: GO:0006694 [steroid biosynthetic process] evidence: IEA
GeneID:706 -> Biological process: GO:0006783 [heme biosynthetic process] evidence: TAS
GeneID:706 -> Biological process: GO:0006820 [anion transport] evidence: TAS
GeneID:706 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:706 -> Biological process: GO:0007568 [aging] evidence: IEA
GeneID:706 -> Biological process: GO:0008202 [steroid metabolic process] evidence: TAS
GeneID:706 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS
GeneID:706 -> Biological process: GO:0008347 [glial cell migration] evidence: IEA
GeneID:706 -> Biological process: GO:0010042 [response to manganese ion] evidence: IEA
GeneID:706 -> Biological process: GO:0010266 [response to vitamin B1] evidence: IEA
GeneID:706 -> Biological process: GO:0010940 [positive regulation of necrotic cell death] evidence: IEA
GeneID:706 -> Biological process: GO:0014012 [peripheral nervous system axon regeneration] evidence: IEA
GeneID:706 -> Biological process: GO:0030325 [adrenal gland development] evidence: IEA
GeneID:706 -> Biological process: GO:0032374 [regulation of cholesterol transport] evidence: TAS
GeneID:706 -> Biological process: GO:0032570 [response to progesterone stimulus] evidence: IEA
GeneID:706 -> Biological process: GO:0032720 [negative regulation of tumor necrosis factor production] evidence: IEA
GeneID:706 -> Biological process: GO:0033574 [response to testosterone stimulus] evidence: IEA
GeneID:706 -> Biological process: GO:0042493 [response to drug] evidence: IEA
GeneID:706 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IEA
GeneID:706 -> Biological process: GO:0045019 [negative regulation of nitric oxide biosynthetic process] evidence: IEA
GeneID:706 -> Biological process: GO:0048266 [behavioral response to pain] evidence: IEA
GeneID:706 -> Biological process: GO:0050810 [regulation of steroid biosynthetic process] evidence: IEA
GeneID:706 -> Biological process: GO:0051901 [positive regulation of mitochondrial depolarization] evidence: IEA
GeneID:706 -> Biological process: GO:0051928 [positive regulation of calcium ion transport] evidence: IEA
GeneID:706 -> Biological process: GO:0060242 [contact inhibition] evidence: IEA
GeneID:706 -> Biological process: GO:0060252 [positive regulation of glial cell proliferation] evidence: IEA
GeneID:706 -> Biological process: GO:0060253 [negative regulation of glial cell proliferation] evidence: IEA
GeneID:706 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IEA
GeneID:706 -> Biological process: GO:0071294 [cellular response to zinc ion] evidence: IEA
GeneID:706 -> Biological process: GO:0071476 [cellular hypotonic response] evidence: IEA
GeneID:706 -> Biological process: GO:2000379 [positive regulation of reactive oxygen species metabolic process] evidence: IEA
GeneID:706 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: IEA
GeneID:706 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.