2024-04-24 21:17:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000657 1207 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens B-cell CLL/lymphoma 2 (BCL2), transcript variant beta, mRNA. ACCESSION NM_000657 VERSION NM_000657.2 GI:72198345 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1207) AUTHORS Li,Y., Zhao,Y., Cheng,Z., Zhan,J., Sun,X., Qian,H., Zhu,W. and Xu,W. TITLE Mesenchymal stem cell-like cells from children foreskin inhibit the growth of SGC-7901 gastric cancer cells JOURNAL Exp. Mol. Pathol. 94 (3), 430-437 (2013) PUBMED 23421973 REMARK GeneRIF: Human mesenchymal stem cell-like cells from foreskin derived conditioned medium inhibited the expression of BCL-2 while increased the expression of BAX and caspase-3 in gastric cancer cells. REFERENCE 2 (bases 1 to 1207) AUTHORS Beverly,L.J., Howell,L.A., Hernandez-Corbacho,M., Casson,L., Chipuk,J.E. and Siskind,L.J. TITLE BAK activation is necessary and sufficient to drive ceramide synthase-dependent ceramide accumulation following inhibition of BCL2-like proteins JOURNAL Biochem. J. 452 (1), 111-119 (2013) PUBMED 23480852 REMARK GeneRIF: Direct inhibition of anti-apoptotic BCL2 proteins is sufficient to induce C16-ceramide synthesis in multiple cell lines, including human leukemia and myeloma cells. REFERENCE 3 (bases 1 to 1207) AUTHORS Chaber,R., Fiszer-Maliszewska,L., Noworolska-Sauren,D., Kwasnicka,J., Wrobel,G. and Chybicka,A. TITLE The BCL-2 protein in precursor B acute lymphoblastic leukemia in children JOURNAL J. Pediatr. Hematol. Oncol. 35 (3), 180-187 (2013) PUBMED 23511489 REMARK GeneRIF: High BCL-2 expression is associated with precursor B acute lymphoblastic leukemia. REFERENCE 4 (bases 1 to 1207) AUTHORS Sezer,C., Yildirim,M., Yildiz,M., Sezgin,A., Donem Dilli,U., Goktas,S. and Bulbuller,N. TITLE Prognostic significance of biological apoptosis factors in gastric cancer JOURNAL J BUON 18 (1), 138-146 (2013) PUBMED 23613399 REMARK GeneRIF: Concurrent evaluation of p53 and Bcl-2 in patients with gastric adenocarcinoma may have prognostic importance. REFERENCE 5 (bases 1 to 1207) AUTHORS Sypniewski,D., Bednarek,I., Galka,S., Loch,T., Blaszczyk,D. and Soltysik,D. TITLE Cytotoxicity of etoposide in cancer cell lines in vitro after BCL-2 and C-RAF gene silencing with antisense oligonucleotides JOURNAL Acta Pol Pharm 70 (1), 87-97 (2013) PUBMED 23610963 REMARK GeneRIF: Antisense oligonucleotides targeting BCL-2 and C-RAF transcripts in tumor cell lines increases sensitivity to cytotoxic effect of etoposide. REFERENCE 6 (bases 1 to 1207) AUTHORS Monaghan,P., Robertson,D., Amos,T.A., Dyer,M.J., Mason,D.Y. and Greaves,M.F. TITLE Ultrastructural localization of bcl-2 protein JOURNAL J. Histochem. Cytochem. 40 (12), 1819-1825 (1992) PUBMED 1453000 REFERENCE 7 (bases 1 to 1207) AUTHORS Alnemri,E.S., Robertson,N.M., Fernandes,T.F., Croce,C.M. and Litwack,G. TITLE Overexpressed full-length human BCL2 extends the survival of baculovirus-infected Sf9 insect cells JOURNAL Proc. Natl. Acad. Sci. U.S.A. 89 (16), 7295-7299 (1992) PUBMED 1502141 REFERENCE 8 (bases 1 to 1207) AUTHORS Borzillo,G.V., Endo,K. and Tsujimoto,Y. TITLE Bcl-2 confers growth and survival advantage to interleukin 7-dependent early pre-B cells which become factor independent by a multistep process in culture JOURNAL Oncogene 7 (5), 869-876 (1992) PUBMED 1373874 REFERENCE 9 (bases 1 to 1207) AUTHORS Tanaka,S., Louie,D.C., Kant,J.A. and Reed,J.C. TITLE Frequent incidence of somatic mutations in translocated BCL2 oncogenes of non-Hodgkin's lymphomas JOURNAL Blood 79 (1), 229-237 (1992) PUBMED 1339299 REFERENCE 10 (bases 1 to 1207) AUTHORS Dublanchet,A. and Durieux,R. TITLE [Isolation of a strain of Streptococcus pneumoniae multiresistant to antibiotics] JOURNAL Nouv Presse Med 8 (11), 872 (1979) PUBMED 36599 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC021803.8 and AI401297.1. On Aug 10, 2005 this sequence version replaced gi:4557356. Summary: This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (beta) differs in the 3' UTR and coding region compared to variant alpha. The resulting isoform (beta) is shorter and has a distinct C-terminus compared to isoform alpha. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BQ056709.1, BG258362.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: reported by MitoCarta ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-207 AC021803.8 38145-38351 208-778 AC021803.8 38573-39143 779-1207 AI401297.1 1-429 c FEATURES Location/Qualifiers source 1..1207 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="18" /map="18q21.3" gene 1..1207 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="B-cell CLL/lymphoma 2" /db_xref="GeneID:596" /db_xref="HGNC:990" /db_xref="MIM:151430" exon 1..207 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /inference="alignment:Splign:1.39.8" variation 65 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /replace="c" /replace="g" /db_xref="dbSNP:1473418" exon 208..1206 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /inference="alignment:Splign:1.39.8" STS 215..493 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /standard_name="GDB:193042" /db_xref="UniSTS:155736" STS 369..1079 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /standard_name="PMC16825P1" /db_xref="UniSTS:271602" misc_feature 392..394 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="upstream in-frame stop codon" STS 454..714 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /standard_name="GDB:182296" /db_xref="UniSTS:155362" CDS 494..1111 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="beta isoform is encoded by transcript variant beta; apoptosis regulator Bcl-2; protein phosphatase 1, regulatory subunit 50" /codon_start=1 /product="apoptosis regulator Bcl-2 beta isoform" /protein_id="NP_000648.2" /db_xref="GI:72198346" /db_xref="CCDS:CCDS45882.1" /db_xref="GeneID:596" /db_xref="HGNC:990" /db_xref="MIM:151430" /translation="
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGALGDVSLG
" misc_feature 494..>1078 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="apoptosis regulator; Region: bcl-2; TIGR00865" /db_xref="CDD:162075" misc_feature 512..583 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="Bcl-2 homology region 4; Region: BH4; pfam02180" /db_xref="CDD:145370" misc_feature 521..583 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P10415.2); Region: BH4" misc_feature 563..565 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01498" misc_feature 593..598 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="Cleavage, by caspase-3; propagated from UniProtKB/Swiss-Prot (P10415.2); cleavage site" misc_feature 593..595 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02799" misc_feature 659..661 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 698..700 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine, by MAPK8; propagated from UniProtKB/Swiss-Prot (P10415.2); phosphorylation site" misc_feature 698..700 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03100" misc_feature 701..703 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by MAPK8 and PKC; propagated from UniProtKB/Swiss-Prot (P10415.2); phosphorylation site" misc_feature 701..703 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03100" misc_feature 713..715 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 752..754 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /db_xref="HPRD:01855" misc_feature 752..754 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by MAPK8; propagated from UniProtKB/Swiss-Prot (P10415.2); phosphorylation site" misc_feature 752..754 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01496" misc_feature 752..754 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03100" misc_feature 770..814 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P10415.2); Region: BH3" misc_feature <773..1084 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="Apoptosis regulator proteins of the Bcl-2 family, named after B-cell lymphoma 2. This alignment model spans what have been described as Bcl-2 homology regions BH1, BH2, BH3, and BH4. Many members of this family have an additional C-terminal transmembrane...; Region: Bcl-2_like; cd06845" /db_xref="CDD:132900" misc_feature 782..808 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="BH3; other site" /db_xref="CDD:132900" misc_feature order(791..796,800..805,815..817,824..829,875..880, 887..892,899..904,920..922,926..931,935..940,950..952, 962..964) /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="BH3-homology region binding site; other site" /db_xref="CDD:132900" misc_feature 899..958 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P10415.2); Region: BH1" misc_feature order(899..907,917..955) /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="BH1; other site" /db_xref="CDD:132900" misc_feature 1052..1084 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /note="BH2; other site" /db_xref="CDD:132900" STS 494..820 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /standard_name="PMC137064P1" /db_xref="UniSTS:270815" variation 514 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /replace="a" /replace="g" /db_xref="dbSNP:1801018" STS 561..1016 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /standard_name="PMC125347P1" /db_xref="UniSTS:270490" variation 620 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /replace="a" /replace="g" /db_xref="dbSNP:1800477" variation 1139 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" /replace="a" /replace="g" /db_xref="dbSNP:4987710" polyA_signal 1186..1191 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" polyA_site 1206 /gene="BCL2" /gene_synonym="Bcl-2; PPP1R50" ORIGIN
tttctgtgaagcagaagtctgggaatcgatctggaaatcctcctaatttttactccctctccccgcgactcctgattcattgggaagtttcaaatcagctataactggagagtgctgaagattgatgggatcgttgccttatgcatttgttttggttttacaaaaaggaaacttgacagaggatcatgctgtacttaaaaaatacaacatcacagaggaagtagactgatattaacaatacttactaataataacgtgcctcatgaaataaagatccgaaaggaattggaataaaaatttcctgcatctcatgccaagggggaaacaccagaatcaagtgttccgcgtgattgaagacaccccctcgtccaagaatgcaaagcacatccaataaaatagctggattataactcctcttctttctctgggggccgtggggtgggagctggggcgagaggtgccgttggcccccgttgcttttcctctgggaaggatggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccattataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccgggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatccagccgcatcccgggacccggtcgccaggacctcgccgctgcagaccccggctgcccccggcgccgccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggccggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggacggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaaccggcacctgcacacctggatccaggataacggaggctgggtaggtgcacttggtgatgtgagtctgggctgaggccacaggtccgagatgcgggggttggagtgcgggtgggctcctggggcaatgggaggctgtggagccggcgaaataaaatcagagttgttgcta
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:596 -> Molecular function: GO:0002020 [protease binding] evidence: IDA GeneID:596 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:596 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IEA GeneID:596 -> Molecular function: GO:0015267 [channel activity] evidence: IDA GeneID:596 -> Molecular function: GO:0016248 [channel inhibitor activity] evidence: IDA GeneID:596 -> Molecular function: GO:0031625 [ubiquitin protein ligase binding] evidence: IPI GeneID:596 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI GeneID:596 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IPI GeneID:596 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IDA GeneID:596 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IPI GeneID:596 -> Molecular function: GO:0051434 [BH3 domain binding] evidence: IPI GeneID:596 -> Molecular function: GO:0051721 [protein phosphatase 2A binding] evidence: IEA GeneID:596 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: IEA GeneID:596 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: IDA GeneID:596 -> Biological process: GO:0001101 [response to acid] evidence: IEA GeneID:596 -> Biological process: GO:0001503 [ossification] evidence: IEA GeneID:596 -> Biological process: GO:0001541 [ovarian follicle development] evidence: IEA GeneID:596 -> Biological process: GO:0001656 [metanephros development] evidence: IEA GeneID:596 -> Biological process: GO:0001658 [branching involved in ureteric bud morphogenesis] evidence: IEA GeneID:596 -> Biological process: GO:0001662 [behavioral fear response] evidence: IEA GeneID:596 -> Biological process: GO:0001782 [B cell homeostasis] evidence: IEA GeneID:596 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: ISS GeneID:596 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: NAS GeneID:596 -> Biological process: GO:0001952 [regulation of cell-matrix adhesion] evidence: IEA GeneID:596 -> Biological process: GO:0002320 [lymphoid progenitor cell differentiation] evidence: IEA GeneID:596 -> Biological process: GO:0002326 [B cell lineage commitment] evidence: IEA GeneID:596 -> Biological process: GO:0003014 [renal system process] evidence: IEA GeneID:596 -> Biological process: GO:0006470 [protein dephosphorylation] evidence: IEA GeneID:596 -> Biological process: GO:0006582 [melanin metabolic process] evidence: IEA GeneID:596 -> Biological process: GO:0006808 [regulation of nitrogen utilization] evidence: IEA GeneID:596 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:596 -> Biological process: GO:0006959 [humoral immune response] evidence: TAS GeneID:596 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IMP GeneID:596 -> Biological process: GO:0007015 [actin filament organization] evidence: IEA GeneID:596 -> Biological process: GO:0007565 [female pregnancy] evidence: NAS GeneID:596 -> Biological process: GO:0007569 [cell aging] evidence: IEA GeneID:596 -> Biological process: GO:0008219 [cell death] evidence: IDA GeneID:596 -> Biological process: GO:0008584 [male gonad development] evidence: IEA GeneID:596 -> Biological process: GO:0008625 [extrinsic apoptotic signaling pathway via death domain receptors] evidence: IDA GeneID:596 -> Biological process: GO:0009314 [response to radiation] evidence: NAS GeneID:596 -> Biological process: GO:0009605 [response to external stimulus] evidence: IEA GeneID:596 -> Biological process: GO:0009636 [response to toxic substance] evidence: IDA GeneID:596 -> Biological process: GO:0009791 [post-embryonic development] evidence: IEA GeneID:596 -> Biological process: GO:0010039 [response to iron ion] evidence: IDA GeneID:596 -> Biological process: GO:0010224 [response to UV-B] evidence: IEA GeneID:596 -> Biological process: GO:0010332 [response to gamma radiation] evidence: IEA GeneID:596 -> Biological process: GO:0010507 [negative regulation of autophagy] evidence: TAS GeneID:596 -> Biological process: GO:0010523 [negative regulation of calcium ion transport into cytosol] evidence: IEA GeneID:596 -> Biological process: GO:0010559 [regulation of glycoprotein biosynthetic process] evidence: IEA GeneID:596 -> Biological process: GO:0014031 [mesenchymal cell development] evidence: IEA GeneID:596 -> Biological process: GO:0014042 [positive regulation of neuron maturation] evidence: IEA GeneID:596 -> Biological process: GO:0014911 [positive regulation of smooth muscle cell migration] evidence: IEA GeneID:596 -> Biological process: GO:0016049 [cell growth] evidence: IEA GeneID:596 -> Biological process: GO:0016337 [cell-cell adhesion] evidence: IEA GeneID:596 -> Biological process: GO:0018105 [peptidyl-serine phosphorylation] evidence: IEA GeneID:596 -> Biological process: GO:0018107 [peptidyl-threonine phosphorylation] evidence: IEA GeneID:596 -> Biological process: GO:0021747 [cochlear nucleus development] evidence: IEA GeneID:596 -> Biological process: GO:0022612 [gland morphogenesis] evidence: IEA GeneID:596 -> Biological process: GO:0022898 [regulation of transmembrane transporter activity] evidence: IDA GeneID:596 -> Biological process: GO:0030279 [negative regulation of ossification] evidence: IEA GeneID:596 -> Biological process: GO:0030307 [positive regulation of cell growth] evidence: IDA GeneID:596 -> Biological process: GO:0030308 [negative regulation of cell growth] evidence: IEA GeneID:596 -> Biological process: GO:0030318 [melanocyte differentiation] evidence: IEA GeneID:596 -> Biological process: GO:0030336 [negative regulation of cell migration] evidence: IEA GeneID:596 -> Biological process: GO:0030890 [positive regulation of B cell proliferation] evidence: IMP GeneID:596 -> Biological process: GO:0031069 [hair follicle morphogenesis] evidence: IEA GeneID:596 -> Biological process: GO:0031103 [axon regeneration] evidence: IEA GeneID:596 -> Biological process: GO:0031647 [regulation of protein stability] evidence: IEA GeneID:596 -> Biological process: GO:0032469 [endoplasmic reticulum calcium ion homeostasis] evidence: IEA GeneID:596 -> Biological process: GO:0032835 [glomerulus development] evidence: IEA GeneID:596 -> Biological process: GO:0032848 [negative regulation of cellular pH reduction] evidence: IDA GeneID:596 -> Biological process: GO:0033033 [negative regulation of myeloid cell apoptotic process] evidence: IEA GeneID:596 -> Biological process: GO:0033077 [T cell differentiation in thymus] evidence: IEA GeneID:596 -> Biological process: GO:0033138 [positive regulation of peptidyl-serine phosphorylation] evidence: IEA GeneID:596 -> Biological process: GO:0033689 [negative regulation of osteoblast proliferation] evidence: IEA GeneID:596 -> Biological process: GO:0034097 [response to cytokine stimulus] evidence: IDA GeneID:596 -> Biological process: GO:0035094 [response to nicotine] evidence: IDA GeneID:596 -> Biological process: GO:0035265 [organ growth] evidence: IEA GeneID:596 -> Biological process: GO:0035872 [nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway] evidence: TAS GeneID:596 -> Biological process: GO:0040018 [positive regulation of multicellular organism growth] evidence: IEA GeneID:596 -> Biological process: GO:0042100 [B cell proliferation] evidence: IDA GeneID:596 -> Biological process: GO:0042493 [response to drug] evidence: IDA GeneID:596 -> Biological process: GO:0042493 [response to drug] evidence: IMP GeneID:596 -> Biological process: GO:0042542 [response to hydrogen peroxide] evidence: IEA GeneID:596 -> Biological process: GO:0043029 [T cell homeostasis] evidence: IEA GeneID:596 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA GeneID:596 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IMP GeneID:596 -> Biological process: GO:0043085 [positive regulation of catalytic activity] evidence: IEA GeneID:596 -> Biological process: GO:0043375 [CD8-positive, alpha-beta T cell lineage commitment] evidence: IEA GeneID:596 -> Biological process: GO:0043496 [regulation of protein homodimerization activity] evidence: IDA GeneID:596 -> Biological process: GO:0043497 [regulation of protein heterodimerization activity] evidence: IDA GeneID:596 -> Biological process: GO:0043524 [negative regulation of neuron apoptotic process] evidence: IDA GeneID:596 -> Biological process: GO:0043583 [ear development] evidence: IEA GeneID:596 -> Biological process: GO:0045069 [regulation of viral genome replication] evidence: IEA GeneID:596 -> Biological process: GO:0045087 [innate immune response] evidence: TAS GeneID:596 -> Biological process: GO:0045636 [positive regulation of melanocyte differentiation] evidence: IEA GeneID:596 -> Biological process: GO:0045930 [negative regulation of mitotic cell cycle] evidence: IEA GeneID:596 -> Biological process: GO:0046671 [negative regulation of retinal cell programmed cell death] evidence: IEA GeneID:596 -> Biological process: GO:0046902 [regulation of mitochondrial membrane permeability] evidence: ISS GeneID:596 -> Biological process: GO:0048041 [focal adhesion assembly] evidence: IEA GeneID:596 -> Biological process: GO:0048536 [spleen development] evidence: IEA GeneID:596 -> Biological process: GO:0048538 [thymus development] evidence: IEA GeneID:596 -> Biological process: GO:0048546 [digestive tract morphogenesis] evidence: IEA GeneID:596 -> Biological process: GO:0048589 [developmental growth] evidence: IEA GeneID:596 -> Biological process: GO:0048599 [oocyte development] evidence: IEA GeneID:596 -> Biological process: GO:0048743 [positive regulation of skeletal muscle fiber development] evidence: IEA GeneID:596 -> Biological process: GO:0048753 [pigment granule organization] evidence: IEA GeneID:596 -> Biological process: GO:0048873 [homeostasis of number of cells within a tissue] evidence: IEA GeneID:596 -> Biological process: GO:0050853 [B cell receptor signaling pathway] evidence: IMP GeneID:596 -> Biological process: GO:0051384 [response to glucocorticoid stimulus] evidence: IEA GeneID:596 -> Biological process: GO:0051402 [neuron apoptotic process] evidence: TAS GeneID:596 -> Biological process: GO:0051607 [defense response to virus] evidence: IDA GeneID:596 -> Biological process: GO:0051881 [regulation of mitochondrial membrane potential] evidence: ISS GeneID:596 -> Biological process: GO:0051902 [negative regulation of mitochondrial depolarization] evidence: TAS GeneID:596 -> Biological process: GO:0051924 [regulation of calcium ion transport] evidence: IDA GeneID:596 -> Biological process: GO:0070059 [intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress] evidence: IDA GeneID:596 -> Biological process: GO:0071310 [cellular response to organic substance] evidence: IEA GeneID:596 -> Biological process: GO:0072593 [reactive oxygen species metabolic process] evidence: IEA GeneID:596 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:596 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS GeneID:596 -> Biological process: GO:2000811 [negative regulation of anoikis] evidence: IMP GeneID:596 -> Biological process: GO:2001234 [negative regulation of apoptotic signaling pathway] evidence: IMP GeneID:596 -> Biological process: GO:2001243 [negative regulation of intrinsic apoptotic signaling pathway] evidence: IDA GeneID:596 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: TAS GeneID:596 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:596 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:596 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA GeneID:596 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: IDA GeneID:596 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS GeneID:596 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IDA GeneID:596 -> Cellular component: GO:0005789 [endoplasmic reticulum membrane] evidence: IEA GeneID:596 -> Cellular component: GO:0005829 [cytosol] evidence: IEA GeneID:596 -> Cellular component: GO:0016020 [membrane] evidence: IDA GeneID:596 -> Cellular component: GO:0031965 [nuclear membrane] evidence: IDA GeneID:596 -> Cellular component: GO:0043209 [myelin sheath] evidence: IEA GeneID:596 -> Cellular component: GO:0046930 [pore complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.