Home |
Help |
Advanced search
2024-04-20 09:40:03, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000633 6492 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens B-cell CLL/lymphoma 2 (BCL2), transcript variant
alpha, mRNA.
ACCESSION NM_000633
VERSION NM_000633.2 GI:72198188
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 6492)
AUTHORS Li,Y., Zhao,Y., Cheng,Z., Zhan,J., Sun,X., Qian,H., Zhu,W. and
Xu,W.
TITLE Mesenchymal stem cell-like cells from children foreskin inhibit the
growth of SGC-7901 gastric cancer cells
JOURNAL Exp. Mol. Pathol. 94 (3), 430-437 (2013)
PUBMED 23421973
REMARK GeneRIF: Human mesenchymal stem cell-like cells from foreskin
derived conditioned medium inhibited the expression of BCL-2 while
increased the expression of BAX and caspase-3 in gastric cancer
cells.
REFERENCE 2 (bases 1 to 6492)
AUTHORS Beverly,L.J., Howell,L.A., Hernandez-Corbacho,M., Casson,L.,
Chipuk,J.E. and Siskind,L.J.
TITLE BAK activation is necessary and sufficient to drive ceramide
synthase-dependent ceramide accumulation following inhibition of
BCL2-like proteins
JOURNAL Biochem. J. 452 (1), 111-119 (2013)
PUBMED 23480852
REMARK GeneRIF: Direct inhibition of anti-apoptotic BCL2 proteins is
sufficient to induce C16-ceramide synthesis in multiple cell lines,
including human leukemia and myeloma cells.
REFERENCE 3 (bases 1 to 6492)
AUTHORS Chaber,R., Fiszer-Maliszewska,L., Noworolska-Sauren,D.,
Kwasnicka,J., Wrobel,G. and Chybicka,A.
TITLE The BCL-2 protein in precursor B acute lymphoblastic leukemia in
children
JOURNAL J. Pediatr. Hematol. Oncol. 35 (3), 180-187 (2013)
PUBMED 23511489
REMARK GeneRIF: High BCL-2 expression is associated with precursor B acute
lymphoblastic leukemia.
REFERENCE 4 (bases 1 to 6492)
AUTHORS Sezer,C., Yildirim,M., Yildiz,M., Sezgin,A., Donem Dilli,U.,
Goktas,S. and Bulbuller,N.
TITLE Prognostic significance of biological apoptosis factors in gastric
cancer
JOURNAL J BUON 18 (1), 138-146 (2013)
PUBMED 23613399
REMARK GeneRIF: Concurrent evaluation of p53 and Bcl-2 in patients with
gastric adenocarcinoma may have prognostic importance.
REFERENCE 5 (bases 1 to 6492)
AUTHORS Sypniewski,D., Bednarek,I., Galka,S., Loch,T., Blaszczyk,D. and
Soltysik,D.
TITLE Cytotoxicity of etoposide in cancer cell lines in vitro after BCL-2
and C-RAF gene silencing with antisense oligonucleotides
JOURNAL Acta Pol Pharm 70 (1), 87-97 (2013)
PUBMED 23610963
REMARK GeneRIF: Antisense oligonucleotides targeting BCL-2 and C-RAF
transcripts in tumor cell lines increases sensitivity to cytotoxic
effect of etoposide.
REFERENCE 6 (bases 1 to 6492)
AUTHORS Monaghan,P., Robertson,D., Amos,T.A., Dyer,M.J., Mason,D.Y. and
Greaves,M.F.
TITLE Ultrastructural localization of bcl-2 protein
JOURNAL J. Histochem. Cytochem. 40 (12), 1819-1825 (1992)
PUBMED 1453000
REFERENCE 7 (bases 1 to 6492)
AUTHORS Alnemri,E.S., Robertson,N.M., Fernandes,T.F., Croce,C.M. and
Litwack,G.
TITLE Overexpressed full-length human BCL2 extends the survival of
baculovirus-infected Sf9 insect cells
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 89 (16), 7295-7299 (1992)
PUBMED 1502141
REFERENCE 8 (bases 1 to 6492)
AUTHORS Borzillo,G.V., Endo,K. and Tsujimoto,Y.
TITLE Bcl-2 confers growth and survival advantage to interleukin
7-dependent early pre-B cells which become factor independent by a
multistep process in culture
JOURNAL Oncogene 7 (5), 869-876 (1992)
PUBMED 1373874
REFERENCE 9 (bases 1 to 6492)
AUTHORS Tanaka,S., Louie,D.C., Kant,J.A. and Reed,J.C.
TITLE Frequent incidence of somatic mutations in translocated BCL2
oncogenes of non-Hodgkin's lymphomas
JOURNAL Blood 79 (1), 229-237 (1992)
PUBMED 1339299
REFERENCE 10 (bases 1 to 6492)
AUTHORS Dublanchet,A. and Durieux,R.
TITLE [Isolation of a strain of Streptococcus pneumoniae multiresistant
to antibiotics]
JOURNAL Nouv Presse Med 8 (11), 872 (1979)
PUBMED 36599
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AC021803.8, BC027258.1 and
AC022726.13.
This sequence is a reference standard in the RefSeqGene project.
On Aug 10, 2005 this sequence version replaced gi:4557354.
Summary: This gene encodes an integral outer mitochondrial membrane
protein that blocks the apoptotic death of some cells such as
lymphocytes. Constitutive expression of BCL2, such as in the case
of translocation of BCL2 to Ig heavy chain locus, is thought to be
the cause of follicular lymphoma. Two transcript variants, produced
by alternate splicing, differ in their C-terminal ends. [provided
by RefSeq, Jul 2008].
Transcript Variant: This variant (alpha) represents the longer
transcript and encodes the longer isoform (alpha).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC027258.1, X06487.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: reported by MitoCarta
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-207 AC021803.8 38145-38351
208-514 AC021803.8 38573-38879
515-2793 BC027258.1 411-2689
2794-6492 AC022726.13 128910-132608
FEATURES Location/Qualifiers
source 1..6492
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="18"
/map="18q21.3"
gene 1..6492
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="B-cell CLL/lymphoma 2"
/db_xref="GeneID:596"
/db_xref="HGNC:990"
/db_xref="MIM:151430"
exon 1..207
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/inference="alignment:Splign:1.39.8"
variation 65
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="c"
/replace="g"
/db_xref="dbSNP:1473418"
exon 208..1078
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/inference="alignment:Splign:1.39.8"
STS 215..493
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="GDB:193042"
/db_xref="UniSTS:155736"
STS 320..1137
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="Bcl2"
/db_xref="UniSTS:266976"
STS 369..1079
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="PMC16825P1"
/db_xref="UniSTS:271602"
misc_feature 392..394
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="upstream in-frame stop codon"
STS 454..714
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="GDB:182296"
/db_xref="UniSTS:155362"
CDS 494..1213
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="alpha isoform is encoded by transcript variant
alpha; apoptosis regulator Bcl-2; protein phosphatase 1,
regulatory subunit 50"
/codon_start=1
/product="apoptosis regulator Bcl-2 alpha isoform"
/protein_id="NP_000624.2"
/db_xref="GI:72198189"
/db_xref="CCDS:CCDS11981.1"
/db_xref="GeneID:596"
/db_xref="HGNC:990"
/db_xref="MIM:151430"
/translation="
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
"
misc_feature 494..1210
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="apoptosis regulator; Region: bcl-2; TIGR00865"
/db_xref="CDD:162075"
misc_feature 512..583
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="Bcl-2 homology region 4; Region: BH4; pfam02180"
/db_xref="CDD:145370"
misc_feature 521..583
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P10415.2);
Region: BH4"
misc_feature 563..565
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01498"
misc_feature 593..598
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="Cleavage, by caspase-3; propagated from
UniProtKB/Swiss-Prot (P10415.2); cleavage site"
misc_feature 593..595
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:02799"
misc_feature 659..661
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 698..700
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by MAPK8; propagated from
UniProtKB/Swiss-Prot (P10415.2); phosphorylation site"
misc_feature 698..700
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03100"
misc_feature 701..703
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by MAPK8 and PKC; propagated from
UniProtKB/Swiss-Prot (P10415.2); phosphorylation site"
misc_feature 701..703
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03100"
misc_feature 701..703
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 713..715
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 752..754
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by MAPK8; propagated from
UniProtKB/Swiss-Prot (P10415.2); phosphorylation site"
misc_feature 752..754
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01496"
misc_feature 752..754
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03100"
misc_feature 770..814
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P10415.2);
Region: BH3"
misc_feature <773..1096
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="Apoptosis regulator proteins of the Bcl-2 family,
named after B-cell lymphoma 2. This alignment model spans
what have been described as Bcl-2 homology regions BH1,
BH2, BH3, and BH4. Many members of this family have an
additional C-terminal transmembrane...; Region:
Bcl-2_like; cd06845"
/db_xref="CDD:132900"
misc_feature 782..808
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="BH3; other site"
/db_xref="CDD:132900"
misc_feature order(791..796,800..805,815..817,824..829,875..880,
887..892,899..904,920..922,926..931,935..940,950..952,
962..964,1094..1096)
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="BH3-homology region binding site; other site"
/db_xref="CDD:132900"
misc_feature 899..958
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P10415.2);
Region: BH1"
misc_feature order(899..907,917..955)
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="BH1; other site"
/db_xref="CDD:132900"
misc_feature 1052..1099
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P10415.2);
Region: BH2"
misc_feature 1052..1096
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/note="BH2; other site"
/db_xref="CDD:132900"
misc_feature 1127..1192
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P10415.2);
transmembrane region"
STS 494..820
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="PMC137064P1"
/db_xref="UniSTS:270815"
variation 514
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:1801018"
STS 561..1016
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="PMC125347P1"
/db_xref="UniSTS:270490"
variation 620
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:1800477"
exon 1079..6492
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/inference="alignment:Splign:1.39.8"
STS 1087..1312
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="GDB:193087"
/db_xref="UniSTS:155740"
STS 1274..1400
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="G10613"
/db_xref="UniSTS:71716"
variation 1471
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="t"
/db_xref="dbSNP:4987842"
STS 1515..1847
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="D18S1264"
/db_xref="UniSTS:8767"
variation 1530
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987843"
variation 1798
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="c"
/db_xref="dbSNP:4987844"
variation 1883
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987845"
variation 1893
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987846"
variation 1997
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:1016860"
variation 2050
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987847"
variation 2155
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987848"
variation 2278
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="c"
/replace="t"
/db_xref="dbSNP:2078303"
variation 2399
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="g"
/replace="t"
/db_xref="dbSNP:4987849"
variation 2417
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:1564483"
STS 2537..3471
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="GDB:216623"
/db_xref="UniSTS:156210"
variation 2555
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987850"
variation 2658
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:1050618"
variation 2812
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987851"
STS 2907..3016
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="RH47111"
/db_xref="UniSTS:12986"
variation 3150
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987852"
STS 3302..3430
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="RH68699"
/db_xref="UniSTS:18898"
variation 3416
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987853"
variation 3445
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987854"
variation 3522
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987855"
variation 3577
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987856"
variation 3627
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="c"
/replace="t"
/db_xref="dbSNP:4987857"
variation 3840
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:17070680"
variation 4033
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="c"
/db_xref="dbSNP:375734256"
polyA_site 4136
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
variation 4277
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="c"
/replace="t"
/db_xref="dbSNP:4987858"
variation 4414
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987859"
variation 4484
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987860"
variation 4507
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="c"
/replace="t"
/db_xref="dbSNP:4987861"
variation 4764
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987862"
variation 4994
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="g"
/replace="t"
/db_xref="dbSNP:4987863"
variation 5175
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="c"
/replace="t"
/db_xref="dbSNP:45520140"
variation 5337
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="g"
/replace="t"
/db_xref="dbSNP:4987864"
variation 5514
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987865"
variation 5601
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace=""
/replace="a"
/db_xref="dbSNP:45489598"
variation 5750
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987866"
variation 5999
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="g"
/db_xref="dbSNP:4987867"
polyA_signal 6181..6186
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
polyA_site 6200
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/experiment="experimental evidence, no additional details
recorded"
STS 6254..6428
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/standard_name="RH78390"
/db_xref="UniSTS:73233"
variation 6262
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="c"
/db_xref="dbSNP:4987868"
variation 6326
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="c"
/replace="t"
/db_xref="dbSNP:45503395"
variation 6341
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace="a"
/replace="c"
/db_xref="dbSNP:4987869"
variation 6384
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
/replace=""
/replace="t"
/db_xref="dbSNP:4987870"
polyA_signal 6469..6474
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
polyA_site 6492
/gene="BCL2"
/gene_synonym="Bcl-2; PPP1R50"
ORIGIN
tttctgtgaagcagaagtctgggaatcgatctggaaatcctcctaatttttactccctctccccgcgactcctgattcattgggaagtttcaaatcagctataactggagagtgctgaagattgatgggatcgttgccttatgcatttgttttggttttacaaaaaggaaacttgacagaggatcatgctgtacttaaaaaatacaacatcacagaggaagtagactgatattaacaatacttactaataataacgtgcctcatgaaataaagatccgaaaggaattggaataaaaatttcctgcatctcatgccaagggggaaacaccagaatcaagtgttccgcgtgattgaagacaccccctcgtccaagaatgcaaagcacatccaataaaatagctggattataactcctcttctttctctgggggccgtggggtgggagctggggcgagaggtgccgttggcccccgttgcttttcctctgggaaggatggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccattataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccgggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatccagccgcatcccgggacccggtcgccaggacctcgccgctgcagaccccggctgcccccggcgccgccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggccggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggacggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaactgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctgctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtgaagtcaacatgcctgccccaaacaaatatgcaaaaggttcactaaagcagtagaaataatatgcattgtcagtgatgtaccatgaaacaaagctgcaggctgtttaagaaaaaataacacacatataaacatcacacacacagacagacacacacacacacaacaattaacagtcttcaggcaaaacgtcgaatcagctatttactgccaaagggaaatatcatttattttttacattattaagaaaaaaagatttatttatttaagacagtcccatcaaaactcctgtctttggaaatccgaccactaattgccaagcaccgcttcgtgtggctccacctggatgttctgtgcctgtaaacatagattcgctttccatgttgttggccggatcaccatctgaagagcagacggatggaaaaaggacctgatcattggggaagctggctttctggctgctggaggctggggagaaggtgttcattcacttgcatttctttgccctgggggctgtgatattaacagagggagggttcctgtggggggaagtccatgcctccctggcctgaagaagagactctttgcatatgactcacatgatgcatacctggtgggaggaaaagagttgggaacttcagatggacctagtacccactgagatttccacgccgaaggacagcgatgggaaaaatgcccttaaatcataggaaagtatttttttaagctaccaattgtgccgagaaaagcattttagcaatttatacaatatcatccagtaccttaagccctgattgtgtatattcatatattttggatacgcaccccccaactcccaatactggctctgtctgagtaagaaacagaatcctctggaacttgaggaagtgaacatttcggtgacttccgcatcaggaaggctagagttacccagagcatcaggccgccacaagtgcctgcttttaggagaccgaagtccgcagaacctgcctgtgtcccagcttggaggcctggtcctggaactgagccggggccctcactggcctcctccagggatgatcaacagggcagtgtggtctccgaatgtctggaagctgatggagctcagaattccactgtcaagaaagagcagtagaggggtgtggctgggcctgtcaccctggggccctccaggtaggcccgttttcacgtggagcatgggagccacgacccttcttaagacatgtatcactgtagagggaaggaacagaggccctgggcccttcctatcagaaggacatggtgaaggctgggaacgtgaggagaggcaatggccacggcccattttggctgtagcacatggcacgttggctgtgtggccttggcccacctgtgagtttaaagcaaggctttaaatgactttggagagggtcacaaatcctaaaagaagcattgaagtgaggtgtcatggattaattgacccctgtctatggaattacatgtaaaacattatcttgtcactgtagtttggttttatttgaaaacctgacaaaaaaaaagttccaggtgtggaatatgggggttatctgtacatcctggggcattaaaaaaaaaatcaatggtggggaactataaagaagtaacaaaagaagtgacatcttcagcaaataaactaggaaatttttttttcttccagtttagaatcagccttgaaacattgatggaataactctgtggcattattgcattatataccatttatctgtattaactttggaatgtactctgttcaatgtttaatgctgtggttgatatttcgaaagctgctttaaaaaaatacatgcatctcagcgtttttttgtttttaattgtatttagttatggcctatacactatttgtgagcaaaggtgatcgttttctgtttgagatttttatctcttgattcttcaaaagcattctgagaaggtgagataagccctgagtctcagctacctaagaaaaacctggatgtcactggccactgaggagctttgtttcaaccaagtcatgtgcatttccacgtcaacagaattgtttattgtgacagttatatctgttgtccctttgaccttgtttcttgaaggtttcctcgtccctgggcaattccgcatttaattcatggtattcaggattacatgcatgtttggttaaacccatgagattcattcagttaaaaatccagatggcaaatgaccagcagattcaaatctatggtggtttgacctttagagagttgctttacgtggcctgtttcaacacagacccacccagagccctcctgccctccttccgcgggggctttctcatggctgtccttcagggtcttcctgaaatgcagtggtgcttacgctccaccaagaaagcaggaaacctgtggtatgaagccagacctccccggcgggcctcagggaacagaatgatcagacctttgaatgattctaatttttaagcaaaatattattttatgaaaggtttacattgtcaaagtgatgaatatggaatatccaatcctgtgctgctatcctgccaaaatcattttaatggagtcagtttgcagtatgctccacgtggtaagatcctccaagctgctttagaagtaacaatgaagaacgtggacgtttttaatataaagcctgttttgtcttttgttgttgttcaaacgggattcacagagtatttgaaaaatgtatatatattaagaggtcacgggggctaattgctggctggctgccttttgctgtggggttttgttacctggttttaataacagtaaatgtgcccagcctcttggccccagaactgtacagtattgtggctgcacttgctctaagagtagttgatgttgcattttccttattgttaaaaacatgttagaagcaatgaatgtatataaaagcctcaactagtcatttttttctcctcttcttttttttcattatatctaattattttgcagttgggcaacagagaaccatccctattttgtattgaagagggattcacatctgcatcttaactgctctttatgaatgaaaaaacagtcctctgtatgtactcctctttacactggccagggtcagagttaaatagagtatatgcactttccaaattggggacaagggctctaaaaaaagccccaaaaggagaagaacatctgagaacctcctcggccctcccagtccctcgctgcacaaatactccgcaagagaggccagaatgacagctgacagggtctatggccatcgggtcgtctccgaagatttggcaggggcagaaaactctggcaggcttaagatttggaataaagtcacagaattaaggaagcacctcaatttagttcaaacaagacgccaacattctctccacagctcacttacctctctgtgttcagatgtggccttccatttatatgtgatctttgttttattagtaaatgcttatcatctaaagatgtagctctggcccagtgggaaaaattaggaagtgattataaatcgagaggagttataataatcaagattaaatgtaaataatcagggcaatcccaacacatgtctagctttcacctccaggatctattgagtgaacagaattgcaaatagtctctatttgtaattgaacttatcctaaaacaaatagtttataaatgtgaacttaaactctaattaattccaactgtacttttaaggcagtggctgtttttagactttcttatcacttatagttagtaatgtacacctactctatcagagaaaaacaggaaaggctcgaaatacaagccattctaaggaaattagggagtcagttgaaattctattctgatcttattctgtggtgtcttttgcagcccagacaaatgtggttacacactttttaagaaatacaattctacattgtcaagcttatgaaggttccaatcagatctttattgttattcaatttggatctttcagggattttttttttaaattattatgggacaaaggacatttgttggaggggtgggagggaggaagaatttttaaatgtaaaacattcccaagtttggatcagggagttggaagttttcagaataaccagaactaagggtatgaaggacctgtattggggtcgatgtgatgcctctgcgaagaaccttgtgtgacaaatgagaaacattttgaagtttgtggtacgacctttagattccagagacatcagcatggctcaaagtgcagctccgtttggcagtgcaatggtataaatttcaagctggatatgtctaatgggtatttaaacaataaatgtgcagttttaactaacaggatatttaatgacaaccttctggttggtagggacatctgtttctaaatgtttattatgtacaatacagaaaaaaattttataaaattaagcaatgtgaaactgaattggagagtgataatacaagtcctttagtcttacccagtgaatcattctgttccatgtctttggacaaccatgaccttggacaatcatgaaatatgcatctcactggatgcaaagaaaatcagatggagcatgaatggtactgtaccggttcatctggactgccccagaaaaataacttcaagcaaacatcctatcaacaacaaggttgttctgcataccaagctgagcacagaagatgggaacactggtggaggatggaaaggctcgctcaatcaagaaaattctgagactattaataaataagactgtagtgtagatactgagtaaatccatgcacctaaaccttttggaaaatctgccgtgggccctccagatagctcatttcattaagtttttccctccaaggtagaatttgcaagagtgacagtggattgcatttcttttggggaagctttcttttggtggttttgtttattataccttcttaagttttcaaccaaggtttgcttttgttttgagttactggggttatttttgttttaaataaaaataagtgtacaataagtgtttttgtattgaaagcttttgttatcaagattttcatacttttaccttccatggctctttttaagattgatacttttaagaggtggctgatattctgcaacactgtacacataaaaaatacggtaaggatactttacatggttaaggtaaagtaagtctccagttggccaccattagctataatggcactttgtttgtgttgttggaaaaagtcacattgccattaaactttccttgtctgtctagttaatattgtgaagaaaaataaagtacagtgtgagatactg
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:596 -> Molecular function: GO:0002020 [protease binding] evidence: IDA
GeneID:596 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:596 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IEA
GeneID:596 -> Molecular function: GO:0015267 [channel activity] evidence: IDA
GeneID:596 -> Molecular function: GO:0016248 [channel inhibitor activity] evidence: IDA
GeneID:596 -> Molecular function: GO:0031625 [ubiquitin protein ligase binding] evidence: IPI
GeneID:596 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI
GeneID:596 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IPI
GeneID:596 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IDA
GeneID:596 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IPI
GeneID:596 -> Molecular function: GO:0051434 [BH3 domain binding] evidence: IPI
GeneID:596 -> Molecular function: GO:0051721 [protein phosphatase 2A binding] evidence: IEA
GeneID:596 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: IEA
GeneID:596 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: IDA
GeneID:596 -> Biological process: GO:0001101 [response to acid] evidence: IEA
GeneID:596 -> Biological process: GO:0001503 [ossification] evidence: IEA
GeneID:596 -> Biological process: GO:0001541 [ovarian follicle development] evidence: IEA
GeneID:596 -> Biological process: GO:0001656 [metanephros development] evidence: IEA
GeneID:596 -> Biological process: GO:0001658 [branching involved in ureteric bud morphogenesis] evidence: IEA
GeneID:596 -> Biological process: GO:0001662 [behavioral fear response] evidence: IEA
GeneID:596 -> Biological process: GO:0001782 [B cell homeostasis] evidence: IEA
GeneID:596 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: ISS
GeneID:596 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: NAS
GeneID:596 -> Biological process: GO:0001952 [regulation of cell-matrix adhesion] evidence: IEA
GeneID:596 -> Biological process: GO:0002320 [lymphoid progenitor cell differentiation] evidence: IEA
GeneID:596 -> Biological process: GO:0002326 [B cell lineage commitment] evidence: IEA
GeneID:596 -> Biological process: GO:0003014 [renal system process] evidence: IEA
GeneID:596 -> Biological process: GO:0006470 [protein dephosphorylation] evidence: IEA
GeneID:596 -> Biological process: GO:0006582 [melanin metabolic process] evidence: IEA
GeneID:596 -> Biological process: GO:0006808 [regulation of nitrogen utilization] evidence: IEA
GeneID:596 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:596 -> Biological process: GO:0006959 [humoral immune response] evidence: TAS
GeneID:596 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IMP
GeneID:596 -> Biological process: GO:0007015 [actin filament organization] evidence: IEA
GeneID:596 -> Biological process: GO:0007565 [female pregnancy] evidence: NAS
GeneID:596 -> Biological process: GO:0007569 [cell aging] evidence: IEA
GeneID:596 -> Biological process: GO:0008219 [cell death] evidence: IDA
GeneID:596 -> Biological process: GO:0008584 [male gonad development] evidence: IEA
GeneID:596 -> Biological process: GO:0008625 [extrinsic apoptotic signaling pathway via death domain receptors] evidence: IDA
GeneID:596 -> Biological process: GO:0009314 [response to radiation] evidence: NAS
GeneID:596 -> Biological process: GO:0009605 [response to external stimulus] evidence: IEA
GeneID:596 -> Biological process: GO:0009636 [response to toxic substance] evidence: IDA
GeneID:596 -> Biological process: GO:0009791 [post-embryonic development] evidence: IEA
GeneID:596 -> Biological process: GO:0010039 [response to iron ion] evidence: IDA
GeneID:596 -> Biological process: GO:0010224 [response to UV-B] evidence: IEA
GeneID:596 -> Biological process: GO:0010332 [response to gamma radiation] evidence: IEA
GeneID:596 -> Biological process: GO:0010507 [negative regulation of autophagy] evidence: TAS
GeneID:596 -> Biological process: GO:0010523 [negative regulation of calcium ion transport into cytosol] evidence: IEA
GeneID:596 -> Biological process: GO:0010559 [regulation of glycoprotein biosynthetic process] evidence: IEA
GeneID:596 -> Biological process: GO:0014031 [mesenchymal cell development] evidence: IEA
GeneID:596 -> Biological process: GO:0014042 [positive regulation of neuron maturation] evidence: IEA
GeneID:596 -> Biological process: GO:0014911 [positive regulation of smooth muscle cell migration] evidence: IEA
GeneID:596 -> Biological process: GO:0016049 [cell growth] evidence: IEA
GeneID:596 -> Biological process: GO:0016337 [cell-cell adhesion] evidence: IEA
GeneID:596 -> Biological process: GO:0018105 [peptidyl-serine phosphorylation] evidence: IEA
GeneID:596 -> Biological process: GO:0018107 [peptidyl-threonine phosphorylation] evidence: IEA
GeneID:596 -> Biological process: GO:0021747 [cochlear nucleus development] evidence: IEA
GeneID:596 -> Biological process: GO:0022612 [gland morphogenesis] evidence: IEA
GeneID:596 -> Biological process: GO:0022898 [regulation of transmembrane transporter activity] evidence: IDA
GeneID:596 -> Biological process: GO:0030279 [negative regulation of ossification] evidence: IEA
GeneID:596 -> Biological process: GO:0030307 [positive regulation of cell growth] evidence: IDA
GeneID:596 -> Biological process: GO:0030308 [negative regulation of cell growth] evidence: IEA
GeneID:596 -> Biological process: GO:0030318 [melanocyte differentiation] evidence: IEA
GeneID:596 -> Biological process: GO:0030336 [negative regulation of cell migration] evidence: IEA
GeneID:596 -> Biological process: GO:0030890 [positive regulation of B cell proliferation] evidence: IMP
GeneID:596 -> Biological process: GO:0031069 [hair follicle morphogenesis] evidence: IEA
GeneID:596 -> Biological process: GO:0031103 [axon regeneration] evidence: IEA
GeneID:596 -> Biological process: GO:0031647 [regulation of protein stability] evidence: IEA
GeneID:596 -> Biological process: GO:0032469 [endoplasmic reticulum calcium ion homeostasis] evidence: IEA
GeneID:596 -> Biological process: GO:0032835 [glomerulus development] evidence: IEA
GeneID:596 -> Biological process: GO:0032848 [negative regulation of cellular pH reduction] evidence: IDA
GeneID:596 -> Biological process: GO:0033033 [negative regulation of myeloid cell apoptotic process] evidence: IEA
GeneID:596 -> Biological process: GO:0033077 [T cell differentiation in thymus] evidence: IEA
GeneID:596 -> Biological process: GO:0033138 [positive regulation of peptidyl-serine phosphorylation] evidence: IEA
GeneID:596 -> Biological process: GO:0033689 [negative regulation of osteoblast proliferation] evidence: IEA
GeneID:596 -> Biological process: GO:0034097 [response to cytokine stimulus] evidence: IDA
GeneID:596 -> Biological process: GO:0035094 [response to nicotine] evidence: IDA
GeneID:596 -> Biological process: GO:0035265 [organ growth] evidence: IEA
GeneID:596 -> Biological process: GO:0035872 [nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway] evidence: TAS
GeneID:596 -> Biological process: GO:0040018 [positive regulation of multicellular organism growth] evidence: IEA
GeneID:596 -> Biological process: GO:0042100 [B cell proliferation] evidence: IDA
GeneID:596 -> Biological process: GO:0042493 [response to drug] evidence: IDA
GeneID:596 -> Biological process: GO:0042493 [response to drug] evidence: IMP
GeneID:596 -> Biological process: GO:0042542 [response to hydrogen peroxide] evidence: IEA
GeneID:596 -> Biological process: GO:0043029 [T cell homeostasis] evidence: IEA
GeneID:596 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA
GeneID:596 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IMP
GeneID:596 -> Biological process: GO:0043085 [positive regulation of catalytic activity] evidence: IEA
GeneID:596 -> Biological process: GO:0043375 [CD8-positive, alpha-beta T cell lineage commitment] evidence: IEA
GeneID:596 -> Biological process: GO:0043496 [regulation of protein homodimerization activity] evidence: IDA
GeneID:596 -> Biological process: GO:0043497 [regulation of protein heterodimerization activity] evidence: IDA
GeneID:596 -> Biological process: GO:0043524 [negative regulation of neuron apoptotic process] evidence: IDA
GeneID:596 -> Biological process: GO:0043583 [ear development] evidence: IEA
GeneID:596 -> Biological process: GO:0045069 [regulation of viral genome replication] evidence: IEA
GeneID:596 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:596 -> Biological process: GO:0045636 [positive regulation of melanocyte differentiation] evidence: IEA
GeneID:596 -> Biological process: GO:0045930 [negative regulation of mitotic cell cycle] evidence: IEA
GeneID:596 -> Biological process: GO:0046671 [negative regulation of retinal cell programmed cell death] evidence: IEA
GeneID:596 -> Biological process: GO:0046902 [regulation of mitochondrial membrane permeability] evidence: ISS
GeneID:596 -> Biological process: GO:0048041 [focal adhesion assembly] evidence: IEA
GeneID:596 -> Biological process: GO:0048536 [spleen development] evidence: IEA
GeneID:596 -> Biological process: GO:0048538 [thymus development] evidence: IEA
GeneID:596 -> Biological process: GO:0048546 [digestive tract morphogenesis] evidence: IEA
GeneID:596 -> Biological process: GO:0048589 [developmental growth] evidence: IEA
GeneID:596 -> Biological process: GO:0048599 [oocyte development] evidence: IEA
GeneID:596 -> Biological process: GO:0048743 [positive regulation of skeletal muscle fiber development] evidence: IEA
GeneID:596 -> Biological process: GO:0048753 [pigment granule organization] evidence: IEA
GeneID:596 -> Biological process: GO:0048873 [homeostasis of number of cells within a tissue] evidence: IEA
GeneID:596 -> Biological process: GO:0050853 [B cell receptor signaling pathway] evidence: IMP
GeneID:596 -> Biological process: GO:0051384 [response to glucocorticoid stimulus] evidence: IEA
GeneID:596 -> Biological process: GO:0051402 [neuron apoptotic process] evidence: TAS
GeneID:596 -> Biological process: GO:0051607 [defense response to virus] evidence: IDA
GeneID:596 -> Biological process: GO:0051881 [regulation of mitochondrial membrane potential] evidence: ISS
GeneID:596 -> Biological process: GO:0051902 [negative regulation of mitochondrial depolarization] evidence: TAS
GeneID:596 -> Biological process: GO:0051924 [regulation of calcium ion transport] evidence: IDA
GeneID:596 -> Biological process: GO:0070059 [intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress] evidence: IDA
GeneID:596 -> Biological process: GO:0071310 [cellular response to organic substance] evidence: IEA
GeneID:596 -> Biological process: GO:0072593 [reactive oxygen species metabolic process] evidence: IEA
GeneID:596 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:596 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS
GeneID:596 -> Biological process: GO:2000811 [negative regulation of anoikis] evidence: IMP
GeneID:596 -> Biological process: GO:2001234 [negative regulation of apoptotic signaling pathway] evidence: IMP
GeneID:596 -> Biological process: GO:2001243 [negative regulation of intrinsic apoptotic signaling pathway] evidence: IDA
GeneID:596 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:596 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:596 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:596 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
GeneID:596 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: IDA
GeneID:596 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS
GeneID:596 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IDA
GeneID:596 -> Cellular component: GO:0005789 [endoplasmic reticulum membrane] evidence: IEA
GeneID:596 -> Cellular component: GO:0005829 [cytosol] evidence: IEA
GeneID:596 -> Cellular component: GO:0016020 [membrane] evidence: IDA
GeneID:596 -> Cellular component: GO:0031965 [nuclear membrane] evidence: IDA
GeneID:596 -> Cellular component: GO:0043209 [myelin sheath] evidence: IEA
GeneID:596 -> Cellular component: GO:0046930 [pore complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.