Home |
Help |
Advanced search
2024-04-26 19:37:34, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000619 1240 bp mRNA linear PRI 15-JUL-2013
DEFINITION Homo sapiens interferon, gamma (IFNG), mRNA.
ACCESSION NM_000619
VERSION NM_000619.2 GI:56786137
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1240)
AUTHORS Olsen,I. and Sollid,L.M.
TITLE Pitfalls in determining the cytokine profile of human T cells
JOURNAL J. Immunol. Methods 390 (1-2), 106-112 (2013)
PUBMED 23416458
REMARK GeneRIF: Data indicate that the dose response curve for phorbol
12-myristate 13-acetate (PMA)/Ionomycin differed for IL-10 compared
to IL-17 and IFN-gamma production by T4 cells.
REFERENCE 2 (bases 1 to 1240)
AUTHORS Pelzel,C., Begitt,A., Wenta,N. and Vinkemeier,U.
TITLE Evidence against a role for beta-arrestin1 in STAT1
dephosphorylation and the inhibition of interferon-gamma signaling
JOURNAL Mol. Cell 50 (1), 149-156 (2013)
PUBMED 23582260
REMARK GeneRIF: Data indicate that beta-arrestin1 is dispensable for STAT1
dephosphorylation and the termination of IFNgamma signaling.
REFERENCE 3 (bases 1 to 1240)
AUTHORS Allison,C.C., Ferrand,J., McLeod,L., Hassan,M.,
Kaparakis-Liaskos,M., Grubman,A., Bhathal,P.S., Dev,A., Sievert,W.,
Jenkins,B.J. and Ferrero,R.L.
TITLE Nucleotide oligomerization domain 1 enhances IFN-gamma signaling in
gastric epithelial cells during Helicobacter pylori infection and
exacerbates disease severity
JOURNAL J. Immunol. 190 (7), 3706-3715 (2013)
PUBMED 23460743
REMARK GeneRIF: cross-talk between NOD1 and IFN-gamma signaling pathways
contribute to H. pylori-induced inflammatory responses, potentially
revealing a novel mechanism whereby virulent H. pylori strains
promote more severe disease.
REFERENCE 4 (bases 1 to 1240)
AUTHORS Teles,R.M., Graeber,T.G., Krutzik,S.R., Montoya,D., Schenk,M.,
Lee,D.J., Komisopoulou,E., Kelly-Scumpia,K., Chun,R., Iyer,S.S.,
Sarno,E.N., Rea,T.H., Hewison,M., Adams,J.S., Popper,S.J.,
Relman,D.A., Stenger,S., Bloom,B.R., Cheng,G. and Modlin,R.L.
TITLE Type I interferon suppresses type II interferon-triggered human
anti-mycobacterial responses
JOURNAL Science 339 (6126), 1448-1453 (2013)
PUBMED 23449998
REMARK GeneRIF: IFN-gamma and its downstream antimicrobial genes were
preferentially expressed in self-healing tuberculoid lesions and
mediated antimicrobial activity against M.leprae in vitro; IFN-beta
and its downstream genes,including IL-10, were induced in monocytes
by M.leprae and preferentially expressed in disseminated and
progressive lepromatous lesions
REFERENCE 5 (bases 1 to 1240)
AUTHORS .
TITLE [The effect of viral infections on the cytokine profile in pregnant
women with obstetric complications and immunotherapy with human
alpha2b interferon]
JOURNAL Vopr. Virusol. 58 (1), 18-23 (2013)
PUBMED 23785756
REMARK GeneRIF: Statistically significant differences in infected women
(groups 1 and 2) in comparison with uninfected women (group 3) were
detected: a) blood plasma concentration of IFNgamma increased in
clinically manifested HPV infection
REFERENCE 6 (bases 1 to 1240)
AUTHORS Emilie,D., Maillot,M.C., Nicolas,J.F., Fior,R. and Galanaud,P.
TITLE Antagonistic effect of interferon-gamma on tat-induced
transactivation of HIV long terminal repeat
JOURNAL J. Biol. Chem. 267 (29), 20565-20570 (1992)
PUBMED 1400376
REFERENCE 7 (bases 1 to 1240)
AUTHORS Grzesiek,S., Dobeli,H., Gentz,R., Garotta,G., Labhardt,A.M. and
Bax,A.
TITLE 1H, 13C, and 15N NMR backbone assignments and secondary structure
of human interferon-gamma
JOURNAL Biochemistry 31 (35), 8180-8190 (1992)
PUBMED 1525157
REFERENCE 8 (bases 1 to 1240)
AUTHORS Slodowski,O., Bohm,J., Schone,B. and Otto,B.
TITLE Carboxy-terminal truncated rhuIFN-gamma with a substitution of
Gln133 or Ser132 to leucine leads to higher biological activity
than in the wild type
JOURNAL Eur. J. Biochem. 202 (3), 1133-1140 (1991)
PUBMED 1662603
REFERENCE 9 (bases 1 to 1240)
AUTHORS Ealick,S.E., Cook,W.J., Vijay-Kumar,S., Carson,M.,
Nagabhushan,T.L., Trotta,P.P. and Bugg,C.E.
TITLE Three-dimensional structure of recombinant human interferon-gamma
JOURNAL Science 252 (5006), 698-702 (1991)
PUBMED 1902591
REFERENCE 10 (bases 1 to 1240)
AUTHORS Silverman,R.H. and Sengupta,D.N.
TITLE Translational regulation by HIV leader RNA, TAT, and
interferon-inducible enzymes
JOURNAL J. Exp. Pathol. 5 (2), 69-77 (1990)
PUBMED 1708818
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC070256.1 and V00543.1.
This sequence is a reference standard in the RefSeqGene project.
On Dec 22, 2004 this sequence version replaced gi:10835170.
Summary: This gene encodes a member of the type II interferon
family. The protein encoded is a soluble cytokine with antiviral,
immunoregulatory and anti-tumor properties and is a potent
activator of macrophages. Mutations in this gene are associated
with aplastic anemia.[provided by RefSeq, Nov 2009].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: X01992.1, BC070256.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-1011 BC070256.1 3-1013
1012-1205 V00543.1 977-1170
1206-1210 BC070256.1 1208-1212
1211-1240 BC070256.1 1215-1244
FEATURES Location/Qualifiers
source 1..1240
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="12"
/map="12q14"
gene 1..1240
/gene="IFNG"
/gene_synonym="IFG; IFI"
/note="interferon, gamma"
/db_xref="GeneID:3458"
/db_xref="HGNC:5438"
/db_xref="MIM:147570"
exon 1..240
/gene="IFNG"
/gene_synonym="IFG; IFI"
/inference="alignment:Splign:1.39.8"
misc_feature 19..21
/gene="IFNG"
/gene_synonym="IFG; IFI"
/note="upstream in-frame stop codon"
STS 106..648
/gene="IFNG"
/gene_synonym="IFG; IFI"
/db_xref="UniSTS:482383"
STS 127..656
/gene="IFNG"
/gene_synonym="IFG; IFI"
/standard_name="GDB:624768"
/db_xref="UniSTS:158355"
CDS 127..627
/gene="IFNG"
/gene_synonym="IFG; IFI"
/note="IFN-gamma; immune interferon"
/codon_start=1
/product="interferon gamma precursor"
/protein_id="NP_000610.2"
/db_xref="GI:56786138"
/db_xref="CCDS:CCDS8980.1"
/db_xref="GeneID:3458"
/db_xref="HGNC:5438"
/db_xref="MIM:147570"
/translation="
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
"
sig_peptide 127..195
/gene="IFNG"
/gene_synonym="IFG; IFI"
mat_peptide 196..624
/gene="IFNG"
/gene_synonym="IFG; IFI"
/product="interferon gamma"
misc_feature 196..552
/gene="IFNG"
/gene_synonym="IFG; IFI"
/note="Interferon gamma; Region: IFN-gamma; pfam00714"
/db_xref="CDD:109758"
misc_feature 196..198
/gene="IFNG"
/gene_synonym="IFG; IFI"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P01579.1);
other site"
misc_feature 268..270
/gene="IFNG"
/gene_synonym="IFG; IFI"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 484..486
/gene="IFNG"
/gene_synonym="IFG; IFI"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
STS 148..636
/gene="IFNG"
/gene_synonym="IFG; IFI"
/standard_name="GDB:624777"
/db_xref="UniSTS:158356"
exon 241..309
/gene="IFNG"
/gene_synonym="IFG; IFI"
/inference="alignment:Splign:1.39.8"
STS 245..478
/gene="IFNG"
/gene_synonym="IFG; IFI"
/standard_name="PMC199428P1"
/db_xref="UniSTS:271866"
STS 247..468
/gene="IFNG"
/gene_synonym="IFG; IFI"
/standard_name="PMC154023P1"
/db_xref="UniSTS:271283"
variation 287
/gene="IFNG"
/gene_synonym="IFG; IFI"
/replace="a"
/replace="g"
/db_xref="dbSNP:76012457"
exon 310..492
/gene="IFNG"
/gene_synonym="IFG; IFI"
/inference="alignment:Splign:1.39.8"
exon 493..1210
/gene="IFNG"
/gene_synonym="IFG; IFI"
/inference="alignment:Splign:1.39.8"
STS 522..624
/gene="IFNG"
/gene_synonym="IFG; IFI"
/standard_name="IFNG"
/db_xref="UniSTS:480107"
STS 634..951
/gene="IFNG"
/gene_synonym="IFG; IFI"
/standard_name="IFNG"
/db_xref="UniSTS:266297"
variation 642
/gene="IFNG"
/gene_synonym="IFG; IFI"
/replace="a"
/replace="g"
/db_xref="dbSNP:1042274"
variation 723
/gene="IFNG"
/gene_synonym="IFG; IFI"
/replace="a"
/replace="g"
/db_xref="dbSNP:2069721"
variation 750
/gene="IFNG"
/gene_synonym="IFG; IFI"
/replace="a"
/replace="t"
/db_xref="dbSNP:2069734"
variation 807
/gene="IFNG"
/gene_synonym="IFG; IFI"
/replace="c"
/replace="t"
/db_xref="dbSNP:2069722"
STS 841..943
/gene="IFNG"
/gene_synonym="IFG; IFI"
/standard_name="PMC135596P1"
/db_xref="UniSTS:270757"
variation 1004
/gene="IFNG"
/gene_synonym="IFG; IFI"
/replace="c"
/replace="t"
/db_xref="dbSNP:2234687"
variation 1166
/gene="IFNG"
/gene_synonym="IFG; IFI"
/replace="a"
/replace="g"
/db_xref="dbSNP:2069723"
polyA_signal 1190..1195
/gene="IFNG"
/gene_synonym="IFG; IFI"
polyA_site 1210
/gene="IFNG"
/gene_synonym="IFG; IFI"
ORIGIN
cacattgttctgatcatctgaagatcagctattagaagagaaagatcagttaagtcctttggacctgatcagcttgatacaagaactactgatttcaacttctttggcttaattctctcggaaacgatgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggctgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgcaggtcattcagatgtagcggataatggaactcttttcttaggcattttgaagaattggaaagaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaactttttaaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatgaatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaattattcggtaactgacttgaatgtccaacgcaaagcaatacatgaactcatccaagtgatggctgaactgtcgccagcagctaaaacagggaagcgaaaaaggagtcagatgctgtttcgaggtcgaagagcatcccagtaatggttgtcctgcctgcaatatttgaattttaaatctaaatctatttattaatatttaacattatttatatggggaatatatttttagactcatcaatcaaataagtatttataatagcaacttttgtgtaatgaaaatgaatatctattaatatatgtattatttataattcctatatcctgtgactgtctcacttaatcctttgttttctgactaattaggcaaggctatgtgattacaaggctttatctcaggggccaactaggcagccaacctaagcaagatcccatgggttgtgtgtttatttcacttgatgatacaatgaacacttataagtgaagtgatactatccagttactgccggtttgaaaatatgcctgcaatctgagccagtgctttaatggcatgtcagacagaacttgaatgtgtcaggtgaccctgatgaaaacatagcatctcaggagatttcatgcctggtgcttccaaatattgttgacaactgtgactgtacccaaatggaaagtaactcatttgttaaaattatcaatatctaatatatatgaataaagtgtaagttcacaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3458 -> Molecular function: GO:0005125 [cytokine activity] evidence: IEA
GeneID:3458 -> Molecular function: GO:0005133 [interferon-gamma receptor binding] evidence: IEA
GeneID:3458 -> Biological process: GO:0000060 [protein import into nucleus, translocation] evidence: IDA
GeneID:3458 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: ISS
GeneID:3458 -> Biological process: GO:0001781 [neutrophil apoptotic process] evidence: IEA
GeneID:3458 -> Biological process: GO:0002026 [regulation of the force of heart contraction] evidence: IEA
GeneID:3458 -> Biological process: GO:0002053 [positive regulation of mesenchymal cell proliferation] evidence: ISS
GeneID:3458 -> Biological process: GO:0002250 [adaptive immune response] evidence: IEA
GeneID:3458 -> Biological process: GO:0002302 [CD8-positive, alpha-beta T cell differentiation involved in immune response] evidence: IEA
GeneID:3458 -> Biological process: GO:0003340 [negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis] evidence: ISS
GeneID:3458 -> Biological process: GO:0006915 [apoptotic process] evidence: IGI
GeneID:3458 -> Biological process: GO:0006928 [cellular component movement] evidence: TAS
GeneID:3458 -> Biological process: GO:0006959 [humoral immune response] evidence: IEA
GeneID:3458 -> Biological process: GO:0007050 [cell cycle arrest] evidence: IDA
GeneID:3458 -> Biological process: GO:0007166 [cell surface receptor signaling pathway] evidence: TAS
GeneID:3458 -> Biological process: GO:0009615 [response to virus] evidence: IDA
GeneID:3458 -> Biological process: GO:0019221 [cytokine-mediated signaling pathway] evidence: TAS
GeneID:3458 -> Biological process: GO:0019882 [antigen processing and presentation] evidence: IEA
GeneID:3458 -> Biological process: GO:0030593 [neutrophil chemotaxis] evidence: IEA
GeneID:3458 -> Biological process: GO:0030968 [endoplasmic reticulum unfolded protein response] evidence: IEA
GeneID:3458 -> Biological process: GO:0031642 [negative regulation of myelination] evidence: IEA
GeneID:3458 -> Biological process: GO:0032224 [positive regulation of synaptic transmission, cholinergic] evidence: IEA
GeneID:3458 -> Biological process: GO:0032700 [negative regulation of interleukin-17 production] evidence: IDA
GeneID:3458 -> Biological process: GO:0032735 [positive regulation of interleukin-12 production] evidence: IDA
GeneID:3458 -> Biological process: GO:0032747 [positive regulation of interleukin-23 production] evidence: IDA
GeneID:3458 -> Biological process: GO:0032760 [positive regulation of tumor necrosis factor production] evidence: IEA
GeneID:3458 -> Biological process: GO:0033141 [positive regulation of peptidyl-serine phosphorylation of STAT protein] evidence: IDA
GeneID:3458 -> Biological process: GO:0033141 [positive regulation of peptidyl-serine phosphorylation of STAT protein] evidence: NAS
GeneID:3458 -> Biological process: GO:0034393 [positive regulation of smooth muscle cell apoptotic process] evidence: IDA
GeneID:3458 -> Biological process: GO:0042102 [positive regulation of T cell proliferation] evidence: IEA
GeneID:3458 -> Biological process: GO:0042493 [response to drug] evidence: IEA
GeneID:3458 -> Biological process: GO:0042511 [positive regulation of tyrosine phosphorylation of Stat1 protein] evidence: IDA
GeneID:3458 -> Biological process: GO:0042742 [defense response to bacterium] evidence: IEA
GeneID:3458 -> Biological process: GO:0042832 [defense response to protozoan] evidence: IEA
GeneID:3458 -> Biological process: GO:0044130 [negative regulation of growth of symbiont in host] evidence: IEA
GeneID:3458 -> Biological process: GO:0045080 [positive regulation of chemokine biosynthetic process] evidence: IEA
GeneID:3458 -> Biological process: GO:0045084 [positive regulation of interleukin-12 biosynthetic process] evidence: IEA
GeneID:3458 -> Biological process: GO:0045348 [positive regulation of MHC class II biosynthetic process] evidence: IEA
GeneID:3458 -> Biological process: GO:0045410 [positive regulation of interleukin-6 biosynthetic process] evidence: IEA
GeneID:3458 -> Biological process: GO:0045429 [positive regulation of nitric oxide biosynthetic process] evidence: IDA
GeneID:3458 -> Biological process: GO:0045666 [positive regulation of neuron differentiation] evidence: IEA
GeneID:3458 -> Biological process: GO:0045672 [positive regulation of osteoclast differentiation] evidence: IDA
GeneID:3458 -> Biological process: GO:0045785 [positive regulation of cell adhesion] evidence: IEA
GeneID:3458 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA
GeneID:3458 -> Biological process: GO:0048304 [positive regulation of isotype switching to IgG isotypes] evidence: IEA
GeneID:3458 -> Biological process: GO:0048662 [negative regulation of smooth muscle cell proliferation] evidence: IDA
GeneID:3458 -> Biological process: GO:0050718 [positive regulation of interleukin-1 beta secretion] evidence: IEA
GeneID:3458 -> Biological process: GO:0050796 [regulation of insulin secretion] evidence: IDA
GeneID:3458 -> Biological process: GO:0051044 [positive regulation of membrane protein ectodomain proteolysis] evidence: IDA
GeneID:3458 -> Biological process: GO:0051607 [defense response to virus] evidence: IEA
GeneID:3458 -> Biological process: GO:0051712 [positive regulation of killing of cells of other organism] evidence: IDA
GeneID:3458 -> Biological process: GO:0060333 [interferon-gamma-mediated signaling pathway] evidence: TAS
GeneID:3458 -> Biological process: GO:0060334 [regulation of interferon-gamma-mediated signaling pathway] evidence: TAS
GeneID:3458 -> Biological process: GO:0060550 [positive regulation of fructose 1,6-bisphosphate 1-phosphatase activity] evidence: IDA
GeneID:3458 -> Biological process: GO:0060552 [positive regulation of fructose 1,6-bisphosphate metabolic process] evidence: IDA
GeneID:3458 -> Biological process: GO:0060557 [positive regulation of vitamin D biosynthetic process] evidence: IDA
GeneID:3458 -> Biological process: GO:0060559 [positive regulation of calcidiol 1-monooxygenase activity] evidence: IDA
GeneID:3458 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IEA
GeneID:3458 -> Biological process: GO:0071351 [cellular response to interleukin-18] evidence: IEA
GeneID:3458 -> Biological process: GO:0072308 [negative regulation of metanephric nephron tubule epithelial cell differentiation] evidence: ISS
GeneID:3458 -> Biological process: GO:0097191 [extrinsic apoptotic signaling pathway] evidence: IDA
GeneID:3458 -> Biological process: GO:2000309 [positive regulation of tumor necrosis factor (ligand) superfamily member 11 production] evidence: IDA
GeneID:3458 -> Cellular component: GO:0005576 [extracellular region] evidence: IDA
GeneID:3458 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
GeneID:3458 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
GeneID:3458 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.