GGRNA Home | Help | Advanced search

2025-07-11 16:35:39, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_000613               1635 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens hemopexin (HPX), mRNA.
ACCESSION   NM_000613
VERSION     NM_000613.2  GI:227430291
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1635)
  AUTHORS   Hahl,P., Davis,T., Washburn,C., Rogers,J.T. and Smith,A.
  TITLE     Mechanisms of neuroprotection by hemopexin: modeling the control of
            heme and iron homeostasis in brain neurons in inflammatory states
  JOURNAL   J. Neurochem. 125 (1), 89-101 (2013)
   PUBMED   23350672
  REMARK    GeneRIF: hemopexin will be neuroprotective after traumatic brain
            injury, with heme release in the CNS, and during the ensuing
            inflammation.
REFERENCE   2  (bases 1 to 1635)
  AUTHORS   Zager,R.A., Johnson,A.C. and Becker,K.
  TITLE     Renal cortical hemopexin accumulation in response to acute kidney
            injury
  JOURNAL   Am. J. Physiol. Renal Physiol. 303 (10), F1460-F1472 (2012)
   PUBMED   22993068
  REMARK    GeneRIF: In sum, these data indicated that AKI-associated hepatic
            stress generates Hpx, which gains renal tubule access.
REFERENCE   3  (bases 1 to 1635)
  AUTHORS   Lin,T., Sammy,F., Yang,H., Thundivalappil,S., Hellman,J.,
            Tracey,K.J. and Warren,H.S.
  TITLE     Identification of hemopexin as an anti-inflammatory factor that
            inhibits synergy of hemoglobin with HMGB1 in sterile and infectious
            inflammation
  JOURNAL   J. Immunol. 189 (4), 2017-2022 (2012)
   PUBMED   22772444
  REMARK    GeneRIF: The findings suggest that hemopexin can modulate the role
            of hemoglobin in sterile and infectious inflammation
REFERENCE   4  (bases 1 to 1635)
  AUTHORS   Law,M.L., Cai,G.Y., Hartz,J.A., Jones,C. and Kao,F.T.
  TITLE     The hemopexin gene maps to the same location as the beta-globin
            gene cluster on human chromosome 11
  JOURNAL   Genomics 3 (1), 48-52 (1988)
   PUBMED   3220477
REFERENCE   5  (bases 1 to 1635)
  AUTHORS   Morgan,W.T., Alam,J., Deaciuc,V., Muster,P., Tatum,F.M. and
            Smith,A.
  TITLE     Interaction of hemopexin with Sn-protoporphyrin IX, an inhibitor of
            heme oxygenase. Role for hemopexin in hepatic uptake of
            Sn-protoporphyrin IX and induction of mRNA for heme oxygenase
  JOURNAL   J. Biol. Chem. 263 (17), 8226-8231 (1988)
   PUBMED   3372522
REFERENCE   6  (bases 1 to 1635)
  AUTHORS   Smith,A., Tatum,F.M., Muster,P., Burch,M.K. and Morgan,W.T.
  TITLE     Importance of ligand-induced conformational changes in hemopexin
            for receptor-mediated heme transport
  JOURNAL   J. Biol. Chem. 263 (11), 5224-5229 (1988)
   PUBMED   2833500
REFERENCE   7  (bases 1 to 1635)
  AUTHORS   Altruda,F., Poli,V., Restagno,G. and Silengo,L.
  TITLE     Structure of the human hemopexin gene and evidence for
            intron-mediated evolution
  JOURNAL   J. Mol. Evol. 27 (2), 102-108 (1988)
   PUBMED   2842511
REFERENCE   8  (bases 1 to 1635)
  AUTHORS   Taketani,S., Kohno,H., Naitoh,Y. and Tokunaga,R.
  TITLE     Isolation of the hemopexin receptor from human placenta
  JOURNAL   J. Biol. Chem. 262 (18), 8668-8671 (1987)
   PUBMED   3036819
REFERENCE   9  (bases 1 to 1635)
  AUTHORS   Altruda,F., Poli,V., Restagno,G., Argos,P., Cortese,R. and
            Silengo,L.
  TITLE     The primary structure of human hemopexin deduced from cDNA
            sequence: evidence for internal, repeating homology
  JOURNAL   Nucleic Acids Res. 13 (11), 3841-3859 (1985)
   PUBMED   2989777
REFERENCE   10 (bases 1 to 1635)
  AUTHORS   Takahashi,N., Takahashi,Y. and Putnam,F.W.
  TITLE     Complete amino acid sequence of human hemopexin, the heme-binding
            protein of serum
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 82 (1), 73-77 (1985)
   PUBMED   3855550
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC005395.1, AK313648.1,
            AV655383.1 and AC084337.7.
            On Apr 23, 2009 this sequence version replaced gi:11321560.
            
            Summary: This gene encodes a plasma glycoprotein that binds heme
            with high affinity. The encoded protein is an acute phase protein
            that transports heme from the plasma to the liver and may be
            involved in protecting cells from oxidative stress. [provided by
            RefSeq, Apr 2009].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC005395.1, J03048.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-803               BC005395.1         1-803
            804-823             AK313648.1         767-786
            824-1609            BC005395.1         805-1590
            1610-1621           AV655383.1         408-419
            1622-1622           AC084337.7         19853-19853         c
            1623-1635           AV655383.1         421-433
FEATURES             Location/Qualifiers
     source          1..1635
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11p15.5-p15.4"
     gene            1..1635
                     /gene="HPX"
                     /gene_synonym="HX"
                     /note="hemopexin"
                     /db_xref="GeneID:3263"
                     /db_xref="HGNC:5171"
                     /db_xref="HPRD:00793"
                     /db_xref="MIM:142290"
     exon            1..144
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     STS             54..237
                     /gene="HPX"
                     /gene_synonym="HX"
                     /standard_name="GDB:197845"
                     /db_xref="UniSTS:155963"
     CDS             62..1450
                     /gene="HPX"
                     /gene_synonym="HX"
                     /EC_number="3.2.1.35"
                     /note="beta-1B-glycoprotein"
                     /codon_start=1
                     /product="hemopexin precursor"
                     /protein_id="NP_000604.1"
                     /db_xref="GI:11321561"
                     /db_xref="CCDS:CCDS7763.1"
                     /db_xref="GeneID:3263"
                     /db_xref="HGNC:5171"
                     /db_xref="HPRD:00793"
                     /db_xref="MIM:142290"
                     /translation="
MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH
"
     sig_peptide     62..130
                     /gene="HPX"
                     /gene_synonym="HX"
     mat_peptide     131..1447
                     /gene="HPX"
                     /gene_synonym="HX"
                     /product="hemopexin"
     misc_feature    131..133
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    149..181
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P02790.2);
                     Region: O-glycosylated at one site"
     misc_feature    200..754
                     /gene="HPX"
                     /gene_synonym="HX"
                     /note="Hemopexin-like repeats.; Hemopexin is a
                     heme-binding protein that transports heme to the liver.
                     Hemopexin-like repeats occur in vitronectin and some
                     matrix metalloproteinases family (matrixins). The HX
                     repeats of some matrixins bind tissue inhibitor of...;
                     Region: HX; cd00094"
                     /db_xref="CDD:28978"
     misc_feature    order(209..211,752..754)
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
                     /citation=[10]
     misc_feature    218..340
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P02790.2);
                     Region: Hemopexin 1"
     misc_feature    order(230..232,236..238,353..355,359..361,491..493,
                     497..499,626..628,632..634)
                     /gene="HPX"
                     /gene_synonym="HX"
                     /note="Metal binding sites [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:28978"
     misc_feature    251..253
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    341..478
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P02790.2);
                     Region: Hemopexin 2"
     misc_feature    479..613
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P02790.2);
                     Region: Hemopexin 3"
     misc_feature    order(506..508,521..523)
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
                     /citation=[10]
     misc_feature    614..754
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P02790.2);
                     Region: Hemopexin 4"
     misc_feature    620..622
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    order(623..625,659..661)
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
                     /citation=[10]
     misc_feature    779..781
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    797..799
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    827..1441
                     /gene="HPX"
                     /gene_synonym="HX"
                     /note="Hemopexin-like repeats.; Hemopexin is a
                     heme-binding protein that transports heme to the liver.
                     Hemopexin-like repeats occur in vitronectin and some
                     matrix metalloproteinases family (matrixins). The HX
                     repeats of some matrixins bind tissue inhibitor of...;
                     Region: HX; cd00094"
                     /db_xref="CDD:28978"
     misc_feature    order(830..832,1439..1441)
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
                     /citation=[10]
     misc_feature    836..973
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P02790.2);
                     Region: Hemopexin 5"
     misc_feature    order(851..853,857..859,986..988,992..994,1142..1144,
                     1148..1150,1271..1273,1277..1279)
                     /gene="HPX"
                     /gene_synonym="HX"
                     /note="Metal binding sites [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:28978"
     misc_feature    974..1117
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P02790.2);
                     Region: Hemopexin 6"
     misc_feature    1130..1249
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P02790.2);
                     Region: Hemopexin 7"
     misc_feature    order(1157..1159,1283..1285)
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
                     /citation=[10]
     misc_feature    1259..1411
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P02790.2);
                     Region: Hemopexin 8"
     misc_feature    order(1313..1315,1364..1366)
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
                     /citation=[10]
     misc_feature    1418..1420
                     /gene="HPX"
                     /gene_synonym="HX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     variation       80
                     /gene="HPX"
                     /gene_synonym="HX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35899065"
     exon            145..203
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     exon            204..275
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     exon            276..397
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     variation       308
                     /gene="HPX"
                     /gene_synonym="HX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12117"
     exon            398..551
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     exon            552..764
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     variation       595
                     /gene="HPX"
                     /gene_synonym="HX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34273718"
     variation       599
                     /gene="HPX"
                     /gene_synonym="HX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:36070033"
     exon            765..896
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     variation       774
                     /gene="HPX"
                     /gene_synonym="HX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34780512"
     exon            897..1027
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     exon            1028..1190
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     exon            1191..1623
                     /gene="HPX"
                     /gene_synonym="HX"
                     /inference="alignment:Splign:1.39.8"
     variation       1212
                     /gene="HPX"
                     /gene_synonym="HX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201246235"
     variation       1237
                     /gene="HPX"
                     /gene_synonym="HX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34557454"
     STS             1346..1560
                     /gene="HPX"
                     /gene_synonym="HX"
                     /standard_name="RH11711"
                     /db_xref="UniSTS:30348"
     STS             1346..1477
                     /gene="HPX"
                     /gene_synonym="HX"
                     /standard_name="RH11711"
                     /db_xref="UniSTS:30348"
     variation       1369
                     /gene="HPX"
                     /gene_synonym="HX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1042547"
     STS             1418..1560
                     /gene="HPX"
                     /gene_synonym="HX"
                     /standard_name="D11S4353"
                     /db_xref="UniSTS:30347"
     STS             1418..1477
                     /gene="HPX"
                     /gene_synonym="HX"
                     /standard_name="D11S4353"
                     /db_xref="UniSTS:30347"
     STS             1458..1580
                     /gene="HPX"
                     /gene_synonym="HX"
                     /standard_name="D11S4588"
                     /db_xref="UniSTS:68264"
     STS             1541..1580
                     /gene="HPX"
                     /gene_synonym="HX"
                     /standard_name="D11S4588"
                     /db_xref="UniSTS:68264"
     polyA_signal    1584..1589
                     /gene="HPX"
                     /gene_synonym="HX"
     polyA_site      1620
                     /gene="HPX"
                     /gene_synonym="HX"
ORIGIN      
aactctatatagggagttcaactggtcacccagagctgtcctgtggcctctgcagctcagcatggctagggtactgggagcacccgttgcactggggttgtggagcctatgctggtctctggccattgccacccctcttcctccgactagtgcccatgggaatgttgctgaaggcgagaccaagccagacccagacgtgactgaacgctgctcagatggctggagctttgatgctaccaccctggatgacaatggaaccatgctgttttttaaaggggagtttgtgtggaagagtcacaaatgggaccgggagttaatctcagagagatggaagaatttccccagccctgtggatgctgcattccgtcaaggtcacaacagtgtctttctgatcaagggggacaaagtctgggtataccctcctgaaaagaaggagaaaggatacccaaagttgctccaagatgaatttcctggaatcccatccccactggatgcagctgtggaatgtcaccgtggagaatgtcaagctgaaggcgtcctcttcttccaaggtgaccgcgagtggttctgggacttggctacgggaaccatgaaggagcgttcctggccagctgttgggaactgctcctctgccctgagatggctgggccgctactactgcttccagggtaaccaattcctgcgcttcgaccctgtcaggggagaggtgcctcccaggtacccgcgggatgtccgagactacttcatgccctgccctggcagaggccatggacacaggaatgggactggccatgggaacagtacccaccatggccctgagtatatgcgctgtagcccacatctagtcttgtctgcactgacgtctgacaaccatggtgccacctatgccttcagtgggacccactactggcgtctggacaccagccgggatggctggcatagctggcccattgctcatcagtggccccagggtccttcagcagtggatgctgccttttcctgggaagaaaaactctatctggtccagggcacccaggtatatgtcttcctgacaaagggaggctataccctagtaagcggttatccgaagcggctggagaaggaagtcgggacccctcatgggattatcctggactctgtggatgcggcctttatctgccctgggtcttctcggctccatatcatggcaggacggcggctgtggtggctggacctgaagtcaggagcccaagccacgtggacagagcttccttggccccatgagaaggtagacggagccttgtgtatggaaaagtcccttggccctaactcatgttccgccaatggtcccggcttgtacctcatccatggtcccaatttgtactgctacagtgatgtggagaaactgaatgcagccaaggcccttccgcaaccccagaatgtgaccagtctcctgggctgcactcactgaggggccttctgacatgagtctggcctggccccacctcctagttcctcataataaagacagattgcttcttcgcttctcactgaggggccttctgacatgagtctggcctggccccacctccccagtttctcataataaagacagattgcttcttcacttgaatcaagggacctaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:3263 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:3263 -> Molecular function: GO:0015232 [heme transporter activity] evidence: TAS
            GeneID:3263 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
            GeneID:3263 -> Biological process: GO:0002639 [positive regulation of immunoglobulin production] evidence: IEA
            GeneID:3263 -> Biological process: GO:0002925 [positive regulation of humoral immune response mediated by circulating immunoglobulin] evidence: IEA
            GeneID:3263 -> Biological process: GO:0006879 [cellular iron ion homeostasis] evidence: TAS
            GeneID:3263 -> Biological process: GO:0015886 [heme transport] evidence: TAS
            GeneID:3263 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
            GeneID:3263 -> Biological process: GO:0020027 [hemoglobin metabolic process] evidence: IEA
            GeneID:3263 -> Biological process: GO:0042168 [heme metabolic process] evidence: IEA
            GeneID:3263 -> Biological process: GO:0042511 [positive regulation of tyrosine phosphorylation of Stat1 protein] evidence: IEA
            GeneID:3263 -> Biological process: GO:0060335 [positive regulation of interferon-gamma-mediated signaling pathway] evidence: IEA
            GeneID:3263 -> Cellular component: GO:0005576 [extracellular region] evidence: NAS
            GeneID:3263 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
            GeneID:3263 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
            GeneID:3263 -> Cellular component: GO:0071682 [endocytic vesicle lumen] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_000604 -> EC 3.2.1.35

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.