Home |
Help |
Advanced search
2024-04-26 15:02:45, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000594 1686 bp mRNA linear PRI 15-JUL-2013
DEFINITION Homo sapiens tumor necrosis factor (TNF), mRNA.
ACCESSION NM_000594
VERSION NM_000594.3 GI:395132451
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1686)
AUTHORS Jiang,H., Khan,S., Wang,Y., Charron,G., He,B., Sebastian,C., Du,J.,
Kim,R., Ge,E., Mostoslavsky,R., Hang,H.C., Hao,Q. and Lin,H.
TITLE SIRT6 regulates TNF-alpha secretion through hydrolysis of
long-chain fatty acyl lysine
JOURNAL Nature 496 (7443), 110-113 (2013)
PUBMED 23552949
REMARK GeneRIF: SIRT6 promotes the secretion of tumour necrosis
factor-alpha by removing the fatty acyl modification on K19 and K20
of TNF-alpha
REFERENCE 2 (bases 1 to 1686)
AUTHORS .
TITLE [The effect of viral infections on the cytokine profile in pregnant
women with obstetric complications and immunotherapy with human
alpha2b interferon]
JOURNAL Vopr. Virusol. 58 (1), 18-23 (2013)
PUBMED 23785756
REMARK GeneRIF: Statistically significant differences in infected women
(groups 1 and 2) in comparison with uninfected women (group 3) were
detected:c) blood plasma concentration of TNFalpha increased in
women with asymptomatic HPV-infection
REFERENCE 3 (bases 1 to 1686)
AUTHORS Romanova,E.N. and Govorin,A.V.
TITLE [TNF-alpha, IL-10, and eNOS gene polymorphisms in patients with
influenza A/H1N1 complicated by pneumonia]
JOURNAL Ter. Arkh. 85 (3), 58-62 (2013)
PUBMED 23720844
REMARK GeneRIF: Patients with influenza-related pneumonia are more
frequently homozygous for the G allele of the TNF 308 G/A
polymorphism.
REFERENCE 4 (bases 1 to 1686)
AUTHORS Melek,K., Ulubay,G., Sarinc Ulasli,S., Verdi,H., Atac,B. and Oner
Eyuboglu,F.
TITLE [Associations between TGF-beta1 G/A and TNF-alpha 308 G/A gene
polymorphisms with airway resistance in chronic obstructive
pulmonary disease]
JOURNAL Tuberk Toraks 61 (1), 1-11 (2013)
PUBMED 23581259
REMARK GeneRIF: results can suggest the lack of association between
TNF-alpha 308 G/A and TGF-beta1 800 G/A gene polymorphisms with
COPD development and airway resistance in Turkish population
REFERENCE 5 (bases 1 to 1686)
AUTHORS Yang,D., Liu,Z. and Luo,Q.
TITLE Plasma ghrelin and pro-inflammatory markers in patients with
obstructive sleep apnea and stable coronary heart disease
JOURNAL Med. Sci. Monit. 19, 251-256 (2013)
PUBMED 23567762
REMARK GeneRIF: Plasma ghrelin levels were increased, and TNF-a and IL-6
were decreased in obstructive sleep apnea patients with and without
coronary heart disease.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1686)
AUTHORS Buonaguro,L., Barillari,G., Chang,H.K., Bohan,C.A., Kao,V.,
Morgan,R., Gallo,R.C. and Ensoli,B.
TITLE Effects of the human immunodeficiency virus type 1 Tat protein on
the expression of inflammatory cytokines
JOURNAL J. Virol. 66 (12), 7159-7167 (1992)
PUBMED 1279199
REFERENCE 7 (bases 1 to 1686)
AUTHORS Zhang,X.M., Weber,I. and Chen,M.J.
TITLE Site-directed mutational analysis of human tumor necrosis
factor-alpha receptor binding site and structure-functional
relationship
JOURNAL J. Biol. Chem. 267 (33), 24069-24075 (1992)
PUBMED 1331108
REFERENCE 8 (bases 1 to 1686)
AUTHORS Stevenson,F.T., Bursten,S.L., Locksley,R.M. and Lovett,D.H.
TITLE Myristyl acylation of the tumor necrosis factor alpha precursor on
specific lysine residues
JOURNAL J. Exp. Med. 176 (4), 1053-1062 (1992)
PUBMED 1402651
REFERENCE 9 (bases 1 to 1686)
AUTHORS Spriggs,D.R., Deutsch,S. and Kufe,D.W.
TITLE Genomic structure, induction, and production of TNF-alpha
JOURNAL Immunol. Ser. 56, 3-34 (1992)
PUBMED 1550865
REMARK Review article
REFERENCE 10 (bases 1 to 1686)
AUTHORS Pryke,A.M., Duggan,C., White,C.P., Posen,S. and Mason,R.S.
TITLE Tumor necrosis factor-alpha induces vitamin D-1-hydroxylase
activity in normal human alveolar macrophages
JOURNAL J. Cell. Physiol. 142 (3), 652-656 (1990)
PUBMED 1690216
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BP215875.1, BC028148.1 and
CA306559.1.
This sequence is a reference standard in the RefSeqGene project.
On Jul 12, 2012 this sequence version replaced gi:25952110.
Summary: This gene encodes a multifunctional proinflammatory
cytokine that belongs to the tumor necrosis factor (TNF)
superfamily. This cytokine is mainly secreted by macrophages. It
can bind to, and thus functions through its receptors
TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the
regulation of a wide spectrum of biological processes including
cell proliferation, differentiation, apoptosis, lipid metabolism,
and coagulation. This cytokine has been implicated in a variety of
diseases, including autoimmune diseases, insulin resistance, and
cancer. Knockout studies in mice also suggested the neuroprotective
function of this cytokine. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BP215875.1, BC028148.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-537 BP215875.1 1-537
538-1672 BC028148.1 520-1654
1673-1686 CA306559.1 1-14 c
FEATURES Location/Qualifiers
source 1..1686
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6p21.3"
gene 1..1686
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/note="tumor necrosis factor"
/db_xref="GeneID:7124"
/db_xref="HGNC:11892"
/db_xref="MIM:191160"
exon 1..361
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/inference="alignment:Splign:1.39.8"
variation 5
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:4248164"
variation 31
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:61761335"
variation 39..40
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace=""
/replace="ag"
/db_xref="dbSNP:4647199"
variation 61..62
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace=""
/replace="c"
/db_xref="dbSNP:201328097"
variation 62..63
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace=""
/replace="c"
/db_xref="dbSNP:4645838"
variation 63
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="g"
/db_xref="dbSNP:3093660"
misc_feature 98..100
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/note="upstream in-frame stop codon"
variation 133
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="t"
/db_xref="dbSNP:372568141"
variation 146
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:372719825"
variation 148
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2515924"
variation 170
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:375864945"
CDS 176..877
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/note="cachectin; TNF, monocyte-derived; TNF,
macrophage-derived; APC1 protein; tumor necrosis
factor-alpha; TNF-a; tumor necrosis factor ligand
superfamily member 2"
/codon_start=1
/product="tumor necrosis factor"
/protein_id="NP_000585.2"
/db_xref="GI:25952111"
/db_xref="CCDS:CCDS4702.1"
/db_xref="GeneID:7124"
/db_xref="HGNC:11892"
/db_xref="MIM:191160"
/translation="
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
"
misc_feature 179..181
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:15110"
misc_feature 230..232
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="myristoylation site"
/citation=[8]
misc_feature 233..235
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="myristoylation site"
/citation=[8]
misc_feature 278..283
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="Cleavage, by SPPL2A or SPPL2B; propagated from
UniProtKB/Swiss-Prot (P01375.1); cleavage site"
misc_feature 281..343
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P01375.1);
transmembrane region"
misc_feature 290..295
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="Cleavage, by SPPL2A or SPPL2B; propagated from
UniProtKB/Swiss-Prot (P01375.1); cleavage site"
misc_feature 320..325
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="Cleavage, by SPPL2A or SPPL2B; propagated from
UniProtKB/Swiss-Prot (P01375.1); cleavage site"
misc_feature 326..331
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="Cleavage, by SPPL2A or SPPL2B; propagated from
UniProtKB/Swiss-Prot (P01375.1); cleavage site"
misc_feature 395..397
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:03793"
misc_feature 395..397
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:04091"
misc_feature 395..397
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:04703"
misc_feature 401..406
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="Cleavage, by ADAM17; propagated from
UniProtKB/Swiss-Prot (P01375.1); cleavage site"
misc_feature 401..403
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:04703"
misc_feature 401..403
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:04091"
misc_feature 410..412
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:04091"
misc_feature 437..868
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/note="Tumor Necrosis Factor; TNF superfamily members
include the cytokines: TNF (TNF-alpha), LT
(lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL),
Fas ligand, and osteoprotegerin (OPG) ligand. These
proteins generally have an intracellular N-terminal...;
Region: TNF; cd00184"
/db_xref="CDD:29146"
misc_feature order(446..448,572..574,578..580,758..760,773..775,
854..856,866..868)
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/note="trimer interface [polypeptide binding]; other site"
/db_xref="CDD:29146"
misc_feature order(488..493,506..508,632..634,653..655,668..670)
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/note="receptor binding sites; other site"
/db_xref="CDD:29146"
STS 176..877
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="GDB:624603"
/db_xref="UniSTS:158353"
variation 177
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369780852"
STS 194..859
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="GDB:624619"
/db_xref="UniSTS:158354"
variation 197
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:374531985"
variation 198
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:201502336"
variation 202
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:377627218"
variation 223
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:146375573"
variation 231
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:377338702"
variation 262
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="g"
/replace="t"
/db_xref="dbSNP:2228088"
STS 272..690
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="Tnf"
/db_xref="UniSTS:144649"
variation 295
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:141667614"
variation 304
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369163834"
variation 312
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200241887"
variation 313
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:144480538"
variation 329
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="c"
/db_xref="dbSNP:3179060"
exon 362..407
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/inference="alignment:Splign:1.39.8"
variation 366
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:35131721"
exon 408..455
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/inference="alignment:Splign:1.39.8"
STS 412..481
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="PMC165077P2"
/db_xref="UniSTS:271532"
variation 413
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369783162"
STS 416..539
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="PMC108024P2"
/db_xref="UniSTS:270131"
STS 426..679
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="PMC165077P1"
/db_xref="UniSTS:271531"
variation 426
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:4645843"
STS 433..587
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="PMC97302P1"
/db_xref="UniSTS:273646"
variation 435
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="c"
/db_xref="dbSNP:190788828"
variation 455
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1800620"
exon 456..1676
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/inference="alignment:Splign:1.39.8"
variation 467
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:375472217"
variation 481
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1800618"
variation 497
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:281865419"
variation 520
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:142488339"
variation 565
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:150508976"
STS 578..807
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="TNF"
/db_xref="UniSTS:264951"
variation 648
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:369510319"
variation 656
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="g"
/replace="t"
/db_xref="dbSNP:373646181"
variation 717
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="c"
/db_xref="dbSNP:140654183"
variation 752
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:180710258"
variation 756
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="t"
/db_xref="dbSNP:11574936"
variation 795
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:376368223"
variation 815
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:141307820"
variation 821
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="g"
/replace="t"
/db_xref="dbSNP:370893734"
STS 838..1136
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="PMC150895P1"
/db_xref="UniSTS:271115"
variation 851
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:186486397"
variation 881
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:190947828"
variation 905
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:372252268"
variation 954
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="c"
/db_xref="dbSNP:3093665"
STS 1087..1252
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="D6S2056"
/db_xref="UniSTS:24864"
variation 1111
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:4645845"
variation 1193..1194
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:79207063"
variation 1194
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:10947218"
variation 1255
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace=""
/replace="t"
/db_xref="dbSNP:55691552"
STS 1266..1424
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/standard_name="STS-X01394"
/db_xref="UniSTS:30071"
variation 1296
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:3093666"
variation 1330
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="g"
/replace="t"
/db_xref="dbSNP:3093667"
variation 1391
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="g"
/replace="t"
/db_xref="dbSNP:28501663"
variation 1486
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="t"
/db_xref="dbSNP:55788986"
variation 1577
/gene="TNF"
/gene_synonym="DIF; TNF-alpha; TNFA; TNFSF2"
/replace="a"
/replace="c"
/db_xref="dbSNP:191617007"
ORIGIN
cagacgctccctcagcaaggacagcagaggaccagctaagagggagagaagcaactacagaccccccctgaaaacaaccctcagacgccacatcccctgacaagctgccaggcaggttctcttcctctcacatactgacccacggctccaccctctctcccctggaaaggacaccatgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaagacaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatcgtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagggaagagttccccagggacctctctctaatcagccctctggcccaggcagtcagatcatcttctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgaggggcagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgagagataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttcaagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgccgtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggagaccccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttccagctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgactttgccgagtctgggcaggtctactttgggatcattgccctgtgaggaggacgaacatccaaccttcccaaacgcctcccctgccccaatccctttattaccccctccttcagacaccctcaacctcttctggctcaaaaagagaattgggggcttagggtcggaacccaagcttagaactttaagcaacaagaccaccacttcgaaacctgggattcaggaatgtgtggcctgcacagtgaagtgctggcaaccactaagaattcaaactggggcctccagaactcactggggcctacagctttgatccctgacatctggaatctggagaccagggagcctttggttctggccagaatgctgcaggacttgagaagacctcacctagaaattgacacaagtggaccttaggccttcctctctccagatgtttccagacttccttgagacacggagcccagccctccccatggagccagctccctctatttatgtttgcacttgtgattatttattatttatttattatttatttatttacagatgaatgtatttatttgggagaccggggtatcctgggggacccaatgtaggagctgccttggctcagacatgttttccgtgaaaacggagctgaacaataggctgttcccatgtagccccctggcctctgtgccttcttttgattatgttttttaaaatatttatctgattaagttgtctaaacaatgctgatttggtgaccaactgtcactcattgctgagcctctgctccccaggggagttgtgtctgtaatcgccctactattcagtggcgagaaataaagtttgcttagaaaagaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:7124 -> Molecular function: GO:0002020 [protease binding] evidence: IPI
GeneID:7124 -> Molecular function: GO:0005125 [cytokine activity] evidence: IDA
GeneID:7124 -> Molecular function: GO:0005164 [tumor necrosis factor receptor binding] evidence: IDA
GeneID:7124 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:7124 -> Molecular function: GO:0042802 [identical protein binding] evidence: IDA
GeneID:7124 -> Molecular function: GO:0044212 [transcription regulatory region DNA binding] evidence: IDA
GeneID:7124 -> Biological process: GO:0000060 [protein import into nucleus, translocation] evidence: IDA
GeneID:7124 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:7124 -> Biological process: GO:0000165 [MAPK cascade] evidence: IMP
GeneID:7124 -> Biological process: GO:0000185 [activation of MAPKKK activity] evidence: IDA
GeneID:7124 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: IDA
GeneID:7124 -> Biological process: GO:0001666 [response to hypoxia] evidence: IEA
GeneID:7124 -> Biological process: GO:0001775 [cell activation] evidence: IEA
GeneID:7124 -> Biological process: GO:0001819 [positive regulation of cytokine production] evidence: IDA
GeneID:7124 -> Biological process: GO:0001934 [positive regulation of protein phosphorylation] evidence: IDA
GeneID:7124 -> Biological process: GO:0002037 [negative regulation of L-glutamate transport] evidence: IEA
GeneID:7124 -> Biological process: GO:0002439 [chronic inflammatory response to antigenic stimulus] evidence: IMP
GeneID:7124 -> Biological process: GO:0002740 [negative regulation of cytokine secretion involved in immune response] evidence: IDA
GeneID:7124 -> Biological process: GO:0002876 [positive regulation of chronic inflammatory response to antigenic stimulus] evidence: IEA
GeneID:7124 -> Biological process: GO:0002925 [positive regulation of humoral immune response mediated by circulating immunoglobulin] evidence: IEA
GeneID:7124 -> Biological process: GO:0003009 [skeletal muscle contraction] evidence: IEA
GeneID:7124 -> Biological process: GO:0006006 [glucose metabolic process] evidence: IEA
GeneID:7124 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:7124 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA
GeneID:7124 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0006927 [transformed cell apoptotic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0006954 [inflammatory response] evidence: IDA
GeneID:7124 -> Biological process: GO:0006959 [humoral immune response] evidence: IEA
GeneID:7124 -> Biological process: GO:0007254 [JNK cascade] evidence: IEA
GeneID:7124 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA
GeneID:7124 -> Biological process: GO:0008625 [extrinsic apoptotic signaling pathway via death domain receptors] evidence: IDA
GeneID:7124 -> Biological process: GO:0008625 [extrinsic apoptotic signaling pathway via death domain receptors] evidence: NAS
GeneID:7124 -> Biological process: GO:0009612 [response to mechanical stimulus] evidence: IEA
GeneID:7124 -> Biological process: GO:0009615 [response to virus] evidence: IDA
GeneID:7124 -> Biological process: GO:0009651 [response to salt stress] evidence: TAS
GeneID:7124 -> Biological process: GO:0009887 [organ morphogenesis] evidence: IEA
GeneID:7124 -> Biological process: GO:0010629 [negative regulation of gene expression] evidence: IDA
GeneID:7124 -> Biological process: GO:0010693 [negative regulation of alkaline phosphatase activity] evidence: IEA
GeneID:7124 -> Biological process: GO:0010888 [negative regulation of lipid storage] evidence: NAS
GeneID:7124 -> Biological process: GO:0010940 [positive regulation of necrotic cell death] evidence: TAS
GeneID:7124 -> Biological process: GO:0014823 [response to activity] evidence: IEA
GeneID:7124 -> Biological process: GO:0019722 [calcium-mediated signaling] evidence: IEA
GeneID:7124 -> Biological process: GO:0030198 [extracellular matrix organization] evidence: IEA
GeneID:7124 -> Biological process: GO:0030316 [osteoclast differentiation] evidence: IEA
GeneID:7124 -> Biological process: GO:0030730 [sequestering of triglyceride] evidence: IDA
GeneID:7124 -> Biological process: GO:0031334 [positive regulation of protein complex assembly] evidence: IDA
GeneID:7124 -> Biological process: GO:0031622 [positive regulation of fever generation] evidence: ISS
GeneID:7124 -> Biological process: GO:0031663 [lipopolysaccharide-mediated signaling pathway] evidence: IDA
GeneID:7124 -> Biological process: GO:0032715 [negative regulation of interleukin-6 production] evidence: IDA
GeneID:7124 -> Biological process: GO:0032722 [positive regulation of chemokine production] evidence: IDA
GeneID:7124 -> Biological process: GO:0032729 [positive regulation of interferon-gamma production] evidence: IEA
GeneID:7124 -> Biological process: GO:0032755 [positive regulation of interleukin-6 production] evidence: IEA
GeneID:7124 -> Biological process: GO:0032800 [receptor biosynthetic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0033138 [positive regulation of peptidyl-serine phosphorylation] evidence: IDA
GeneID:7124 -> Biological process: GO:0033209 [tumor necrosis factor-mediated signaling pathway] evidence: IMP
GeneID:7124 -> Biological process: GO:0034116 [positive regulation of heterotypic cell-cell adhesion] evidence: IDA
GeneID:7124 -> Biological process: GO:0042346 [positive regulation of NF-kappaB import into nucleus] evidence: IDA
GeneID:7124 -> Biological process: GO:0042493 [response to drug] evidence: IEA
GeneID:7124 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0043068 [positive regulation of programmed cell death] evidence: IDA
GeneID:7124 -> Biological process: GO:0043122 [regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IDA
GeneID:7124 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IDA
GeneID:7124 -> Biological process: GO:0043242 [negative regulation of protein complex disassembly] evidence: IDA
GeneID:7124 -> Biological process: GO:0043243 [positive regulation of protein complex disassembly] evidence: IDA
GeneID:7124 -> Biological process: GO:0043280 [positive regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0043406 [positive regulation of MAP kinase activity] evidence: IDA
GeneID:7124 -> Biological process: GO:0043491 [protein kinase B signaling cascade] evidence: IMP
GeneID:7124 -> Biological process: GO:0043507 [positive regulation of JUN kinase activity] evidence: IDA
GeneID:7124 -> Biological process: GO:0043525 [positive regulation of neuron apoptotic process] evidence: IEA
GeneID:7124 -> Biological process: GO:0044130 [negative regulation of growth of symbiont in host] evidence: IEA
GeneID:7124 -> Biological process: GO:0045071 [negative regulation of viral genome replication] evidence: IDA
GeneID:7124 -> Biological process: GO:0045080 [positive regulation of chemokine biosynthetic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0045416 [positive regulation of interleukin-8 biosynthetic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0045429 [positive regulation of nitric oxide biosynthetic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0045599 [negative regulation of fat cell differentiation] evidence: NAS
GeneID:7124 -> Biological process: GO:0045668 [negative regulation of osteoblast differentiation] evidence: IEA
GeneID:7124 -> Biological process: GO:0045672 [positive regulation of osteoclast differentiation] evidence: IDA
GeneID:7124 -> Biological process: GO:0045840 [positive regulation of mitosis] evidence: IEA
GeneID:7124 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IDA
GeneID:7124 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IDA
GeneID:7124 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:7124 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IGI
GeneID:7124 -> Biological process: GO:0045994 [positive regulation of translational initiation by iron] evidence: IEA
GeneID:7124 -> Biological process: GO:0046325 [negative regulation of glucose import] evidence: IEA
GeneID:7124 -> Biological process: GO:0046330 [positive regulation of JNK cascade] evidence: IEA
GeneID:7124 -> Biological process: GO:0048566 [embryonic digestive tract development] evidence: IEP
GeneID:7124 -> Biological process: GO:0048661 [positive regulation of smooth muscle cell proliferation] evidence: IDA
GeneID:7124 -> Biological process: GO:0050715 [positive regulation of cytokine secretion] evidence: IDA
GeneID:7124 -> Biological process: GO:0050796 [regulation of insulin secretion] evidence: IDA
GeneID:7124 -> Biological process: GO:0050806 [positive regulation of synaptic transmission] evidence: IEA
GeneID:7124 -> Biological process: GO:0050830 [defense response to Gram-positive bacterium] evidence: IEA
GeneID:7124 -> Biological process: GO:0050901 [leukocyte tethering or rolling] evidence: IDA
GeneID:7124 -> Biological process: GO:0050995 [negative regulation of lipid catabolic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0051023 [regulation of immunoglobulin secretion] evidence: IEA
GeneID:7124 -> Biological process: GO:0051044 [positive regulation of membrane protein ectodomain proteolysis] evidence: IDA
GeneID:7124 -> Biological process: GO:0051091 [positive regulation of sequence-specific DNA binding transcription factor activity] evidence: IDA
GeneID:7124 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: IDA
GeneID:7124 -> Biological process: GO:0051222 [positive regulation of protein transport] evidence: IDA
GeneID:7124 -> Biological process: GO:0051384 [response to glucocorticoid stimulus] evidence: IDA
GeneID:7124 -> Biological process: GO:0051533 [positive regulation of NFAT protein import into nucleus] evidence: IDA
GeneID:7124 -> Biological process: GO:0051798 [positive regulation of hair follicle development] evidence: IEA
GeneID:7124 -> Biological process: GO:0051897 [positive regulation of protein kinase B signaling cascade] evidence: IEA
GeneID:7124 -> Biological process: GO:0060555 [activation of necroptosis by extracellular signals] evidence: IDA
GeneID:7124 -> Biological process: GO:0060557 [positive regulation of vitamin D biosynthetic process] evidence: IDA
GeneID:7124 -> Biological process: GO:0060559 [positive regulation of calcidiol 1-monooxygenase activity] evidence: IDA
GeneID:7124 -> Biological process: GO:0060664 [epithelial cell proliferation involved in salivary gland morphogenesis] evidence: IEA
GeneID:7124 -> Biological process: GO:0060693 [regulation of branching involved in salivary gland morphogenesis] evidence: IEA
GeneID:7124 -> Biological process: GO:0061048 [negative regulation of branching involved in lung morphogenesis] evidence: IDA
GeneID:7124 -> Biological process: GO:0070265 [necrotic cell death] evidence: IDA
GeneID:7124 -> Biological process: GO:0070374 [positive regulation of ERK1 and ERK2 cascade] evidence: NAS
GeneID:7124 -> Biological process: GO:0071230 [cellular response to amino acid stimulus] evidence: IEA
GeneID:7124 -> Biological process: GO:0071316 [cellular response to nicotine] evidence: IDA
GeneID:7124 -> Biological process: GO:0071407 [cellular response to organic cyclic compound] evidence: IDA
GeneID:7124 -> Biological process: GO:0071677 [positive regulation of mononuclear cell migration] evidence: NAS
GeneID:7124 -> Biological process: GO:0071803 [positive regulation of podosome assembly] evidence: IDA
GeneID:7124 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS
GeneID:7124 -> Biological process: GO:0097191 [extrinsic apoptotic signaling pathway] evidence: IDA
GeneID:7124 -> Biological process: GO:2000010 [positive regulation of protein localization to cell surface] evidence: IDA
GeneID:7124 -> Biological process: GO:2000343 [positive regulation of chemokine (C-X-C motif) ligand 2 production] evidence: IDA
GeneID:7124 -> Biological process: GO:2001240 [negative regulation of extrinsic apoptotic signaling pathway in absence of ligand] evidence: IDA
GeneID:7124 -> Cellular component: GO:0001891 [phagocytic cup] evidence: ISS
GeneID:7124 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
GeneID:7124 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
GeneID:7124 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:7124 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: IDA
GeneID:7124 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: ISS
GeneID:7124 -> Cellular component: GO:0009986 [cell surface] evidence: IDA
GeneID:7124 -> Cellular component: GO:0045121 [membrane raft] evidence: IDA
GeneID:7124 -> Cellular component: GO:0055037 [recycling endosome] evidence: ISS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.