GGRNA Home | Help | Advanced search

2019-03-25 14:52:52, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_000579               3686 bp    mRNA    linear   PRI 15-JUL-2013
DEFINITION  Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene)
            (CCR5), transcript variant A, mRNA.
ACCESSION   NM_000579 NM_001105536 XM_001125981
VERSION     NM_000579.3  GI:154091329
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3686)
  AUTHORS   Steen,A., Thiele,S., Guo,D., Hansen,L.S., Frimurer,T.M. and
            Rosenkilde,M.M.
  TITLE     Biased and constitutive signaling in the CC-chemokine receptor CCR5
            by manipulating the interface between transmembrane helices 6 and 7
  JOURNAL   J. Biol. Chem. 288 (18), 12511-12521 (2013)
   PUBMED   23493400
  REMARK    GeneRIF: These results provide important information on the
            molecular interplay and impact of TM6 and TM7 for CCR5 activity,
            which may be extrapolated to other chemokine receptors and possibly
            to other 7TM receptors.
REFERENCE   2  (bases 1 to 3686)
  AUTHORS   Schnur,E., Kessler,N., Zherdev,Y., Noah,E., Scherf,T., Ding,F.X.,
            Rabinovich,S., Arshava,B., Kurbatska,V., Leonciks,A., Tsimanis,A.,
            Rosen,O., Naider,F. and Anglister,J.
  TITLE     NMR mapping of RANTES surfaces interacting with CCR5 using linked
            extracellular domains
  JOURNAL   FEBS J. 280 (9), 2068-2084 (2013)
   PUBMED   23480650
  REMARK    GeneRIF: N-terminal-CCR5 and extracellular loop 2 are the major
            contributors to CCR5 binding to RANTES.
REFERENCE   3  (bases 1 to 3686)
  AUTHORS   Bjorkander,S., Heidari-Hamedani,G., Bremme,K., Gunnarsson,I. and
            Holmlund,U.
  TITLE     Peripheral monocyte expression of the chemokine receptors CCR2,
            CCR5 and CXCR3 is altered at parturition in healthy women and in
            women with systemic lupus erythematosus
  JOURNAL   Scand. J. Immunol. 77 (3), 200-212 (2013)
   PUBMED   23298254
  REMARK    GeneRIF: Data indicate that women with systemic lupus erythematosus
            (SLE) responded similar to pregnancy as did healthy women with
            lower percentages of CCR2+, CCR5+ and CXCR3+ monocytes.
REFERENCE   4  (bases 1 to 3686)
  AUTHORS   de Voux,A., Chan,M.C., Folefoc,A.T., Madziva,M.T. and Flanagan,C.A.
  TITLE     Constitutively active CCR5 chemokine receptors differ in mediating
            HIV envelope-dependent fusion
  JOURNAL   PLoS ONE 8 (1), E54532 (2013)
   PUBMED   23355876
  REMARK    GeneRIF: Constitutively active CCR5 chemokine receptors differ in
            mediating HIV envelope-dependent fusion.
REFERENCE   5  (bases 1 to 3686)
  AUTHORS   Ivanoshchuk,D.E., Mikhailova,S.V., Kulikov,I.V., Maksimov,V.N.,
            Voevoda,M.I. and Romashchenko,A.G.
  TITLE     [CCR5, CCR2, apoe, p53, ITGB3 and HFE gene polymorphism in Western
            Siberia long-livers]
  JOURNAL   Adv Gerontol 25 (3), 394-397 (2012)
   PUBMED   23289212
  REMARK    GeneRIF: carriage of the delta32 polymorphism for the CCR5 gene,
            does not influence on predisposition to the longevity.
REFERENCE   6  (bases 1 to 3686)
  AUTHORS   Madsen,H.O., Poulsen,K., Dahl,O., Clark,B.F. and Hjorth,J.P.
  TITLE     Retropseudogenes constitute the major part of the human elongation
            factor 1 alpha gene family
  JOURNAL   Nucleic Acids Res. 18 (6), 1513-1516 (1990)
   PUBMED   2183196
REFERENCE   7  (bases 1 to 3686)
  AUTHORS   Whiteheart,S.W., Shenbagamurthi,P., Chen,L., Cotter,R.J. and
            Hart,G.W.
  TITLE     Murine elongation factor 1 alpha (EF-1 alpha) is
            posttranslationally modified by novel amide-linked
            ethanolamine-phosphoglycerol moieties. Addition of
            ethanolamine-phosphoglycerol to specific glutamic acid residues on
            EF-1 alpha
  JOURNAL   J. Biol. Chem. 264 (24), 14334-14341 (1989)
   PUBMED   2569467
REFERENCE   8  (bases 1 to 3686)
  AUTHORS   Uetsuki,T., Naito,A., Nagata,S. and Kaziro,Y.
  TITLE     Isolation and characterization of the human chromosomal gene for
            polypeptide chain elongation factor-1 alpha
  JOURNAL   J. Biol. Chem. 264 (10), 5791-5798 (1989)
   PUBMED   2564392
REFERENCE   9  (bases 1 to 3686)
  AUTHORS   Itoh,H., Toyama,R., Kozasa,T., Tsukamoto,T., Matsuoka,M. and
            Kaziro,Y.
  TITLE     Presence of three distinct molecular species of Gi protein alpha
            subunit. Structure of rat cDNAs and human genomic DNAs
  JOURNAL   J. Biol. Chem. 263 (14), 6656-6664 (1988)
   PUBMED   2834384
REFERENCE   10 (bases 1 to 3686)
  AUTHORS   Ann,D.K., Wu,M.M., Huang,T., Carlson,D.M. and Wu,R.
  TITLE     Retinol-regulated gene expression in human tracheobronchial
            epithelial cells. Enhanced expression of elongation factor EF-1
            alpha
  JOURNAL   J. Biol. Chem. 263 (8), 3546-3549 (1988)
   PUBMED   3346208
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC098613.2, DA818906.1,
            U54994.1 and BC038398.1.
            This sequence is a reference standard in the RefSeqGene project.
            On or before Mar 27, 2009 this sequence version replaced
            gi:157671960, gi:118572593.
            
            Summary: This gene encodes a member of the beta chemokine receptor
            family, which is predicted to be a seven transmembrane protein
            similar to G protein-coupled receptors. This protein is expressed
            by T cells and macrophages, and is known to be an important
            co-receptor for macrophage-tropic virus, including HIV, to enter
            host cells. Defective alleles of this gene have been associated
            with the HIV infection resistance. The ligands of this receptor
            include monocyte chemoattractant protein 2 (MCP-2), macrophage
            inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory
            protein 1 beta (MIP-1 beta) and regulated on activation normal T
            expressed and secreted protein (RANTES). Expression of this gene
            was also detected in a promyeloblastic cell line, suggesting that
            this protein may play a role in granulocyte lineage proliferation
            and differentiation. This gene is located at the chemokine receptor
            gene cluster region. Two transcript variants encoding the same
            protein have been found for this gene. [provided by RefSeq, Jul
            2008].
            
            Transcript Variant: This variant (A) represents the longer
            transcript. Both variants encode the same protein.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data because no single transcript was available
            for the full length of the gene. The extent of this transcript is
            supported by published experimental evidence.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            CDS exon combination :: U54994.1, BC038398.1 [ECO:0000331]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-57                AC098613.2         26671-26727
            58-211              AC098613.2         27229-27382
            212-767             DA818906.1         1-556
            768-2433            U54994.1           465-2130
            2434-3134           BC038398.1         2120-2820
            3135-3275           U54994.1           2832-2972
            3276-3686           BC038398.1         2962-3372
FEATURES             Location/Qualifiers
     source          1..3686
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3p21.31"
     gene            1..3686
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /note="chemokine (C-C motif) receptor 5 (gene/pseudogene)"
                     /db_xref="GeneID:1234"
                     /db_xref="HGNC:1606"
                     /db_xref="HPRD:03223"
                     /db_xref="MIM:601373"
     exon            1..57
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="alignment:Splign:1.39.8"
     variation       29
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2856758"
     variation       43
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2856759"
     exon            58..346
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="alignment:Splign:1.39.8"
     variation       111
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147420214"
     variation       115
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201495177"
     variation       116
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200068037"
     variation       126
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1799988"
     variation       129
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41469351"
     variation       140
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3087249"
     variation       149
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2856760"
     variation       175
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1800023"
     variation       183
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200298802"
     variation       195
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201042276"
     variation       204
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111233598"
     variation       211
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202208604"
     variation       213
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:41355345"
     variation       235
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3087250"
     misc_feature    277..279
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /note="upstream in-frame stop codon"
     exon            347..3661
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="alignment:Splign:1.39.8"
     variation       348
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:184985767"
     CDS             358..1416
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /note="chemr13; C-C motif chemokine receptor 5 A159A;
                     chemokine receptor CCR5; HIV-1 fusion coreceptor"
                     /codon_start=1
                     /product="C-C chemokine receptor type 5"
                     /protein_id="NP_000570.1"
                     /db_xref="GI:4502639"
                     /db_xref="CCDS:CCDS2739.1"
                     /db_xref="GeneID:1234"
                     /db_xref="HGNC:1606"
                     /db_xref="HPRD:03223"
                     /db_xref="MIM:601373"
                     /translation="
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
"
     misc_feature    364..366
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Sulfotyrosine; propagated from UniProtKB/Swiss-Prot
                     (P51681.1); sulfatation site"
     misc_feature    364..366
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="sulfatation site"
     misc_feature    373..375
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    385..387
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Sulfotyrosine; propagated from UniProtKB/Swiss-Prot
                     (P51681.1); sulfatation site"
     misc_feature    385..387
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="sulfatation site"
     misc_feature    394..1338
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /note="chemokine receptor-like protein; Provisional;
                     Region: PHA02834"
                     /db_xref="CDD:165177"
     misc_feature    397..399
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Sulfotyrosine; propagated from UniProtKB/Swiss-Prot
                     (P51681.1); sulfatation site"
     misc_feature    397..399
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="sulfatation site"
     misc_feature    400..402
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="sulfatation site"
     misc_feature    448..531
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    562..624
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    664..729
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    781..855
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    952..1011
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    1063..1137
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    1189..1260
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P51681.1);
                     transmembrane region"
     misc_feature    1318..1320
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="palmitoylation site; modified site"
     misc_feature    1324..1326
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="palmitoylation site; modified site"
     misc_feature    1327..1329
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="palmitoylation site; modified site"
     misc_feature    1363..1365
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by BARK1; propagated from
                     UniProtKB/Swiss-Prot (P51681.1); phosphorylation site"
     misc_feature    1363..1365
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:00183"
     misc_feature    1366..1368
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by BARK1; propagated from
                     UniProtKB/Swiss-Prot (P51681.1); phosphorylation site"
     misc_feature    1366..1368
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:00183"
     misc_feature    1381..1383
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by BARK1; propagated from
                     UniProtKB/Swiss-Prot (P51681.1); phosphorylation site"
     misc_feature    1381..1383
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:00183"
     misc_feature    1402..1404
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by BARK1; propagated from
                     UniProtKB/Swiss-Prot (P51681.1); phosphorylation site"
     misc_feature    1402..1404
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:00183"
     variation       400
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200209014"
     variation       407
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369206494"
     variation       409
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142904831"
     variation       415
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145061115"
     variation       434
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189601230"
     variation       442
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800939"
     variation       449
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56340326"
     variation       451
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374426321"
     variation       462
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113471490"
     variation       493
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41425744"
     variation       521
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1799863"
     variation       522
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148106779"
     variation       537
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800940"
     variation       544
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142829420"
     variation       557
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199722561"
     variation       573
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143880323"
     variation       575
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56198941"
     variation       582
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800941"
     variation       634
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376364792"
     variation       640
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149975182"
     variation       660
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1800560"
     variation       666
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:56068070"
     variation       673
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183662584"
     variation       676
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138174483"
     variation       695
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200815713"
     variation       715
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370409212"
     variation       717
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200108729"
     variation       719
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150497029"
     variation       729
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138380934"
     variation       730
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146209111"
     variation       739
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201179081"
     variation       748
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:34418657"
     variation       779
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371901382"
     variation       834
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55639502"
     variation       849
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1800942"
     variation       851
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372054532"
     variation       863
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376687230"
     variation       872
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377330713"
     variation       888
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369351284"
     variation       889
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199824195"
     variation       911..942
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace=""
                     /replace="gtcagtatcaattctggaagaatttccagaca"
                     /db_xref="dbSNP:333"
     variation       911
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:112590754"
     variation       912
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111718604"
     variation       913
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:113869679"
     variation       917
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372782701"
     variation       925
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201797884"
     variation       932
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:199827265"
     variation       936
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:56345960"
     variation       939
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:62625034"
     STS             965..1394
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /standard_name="D3S4504"
                     /db_xref="UniSTS:474434"
     variation       974
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113552054"
     variation       975
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139737901"
     variation       1002
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376137306"
     variation       1004
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371598347"
     variation       1016
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151126808"
     variation       1023
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201290940"
     variation       1024
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200419576"
     variation       1025
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1800452"
     variation       1030
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146972949"
     variation       1035
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373358134"
     variation       1057
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371621013"
     variation       1062
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147615392"
     variation       1076
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199780106"
     variation       1079
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201301850"
     variation       1094
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143181119"
     variation       1098
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141139165"
     variation       1116
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367851873"
     variation       1127
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142469507"
     variation       1163
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184279915"
     variation       1181
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:112762802"
     STS             1194..1377
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /standard_name="RH65248"
                     /db_xref="UniSTS:88902"
     variation       1196
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374495269"
     STS             1206..1382
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /standard_name="STS-X91492"
                     /db_xref="UniSTS:43626"
     variation       1217
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:55956105"
     variation       1219
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150592242"
     variation       1221
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372879037"
     variation       1224
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149622978"
     variation       1228
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200740810"
     variation       1231
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375777270"
     variation       1239
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368391698"
     variation       1258
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55916127"
     variation       1259
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800943"
     variation       1302
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371813238"
     variation       1309
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188772198"
     variation       1312
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374959868"
     variation       1313
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369373756"
     variation       1341
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372786661"
     variation       1345..1346
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34962689"
     variation       1347
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35853487"
     variation       1348
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199846907"
     variation       1350
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201780857"
     variation       1353
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148802293"
     variation       1357
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147879075"
     variation       1361
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800944"
     variation       1373
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1800945"
     variation       1388
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375916464"
     variation       1395
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2157060"
     variation       1419
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191297617"
     variation       1528
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146080174"
     variation       1610
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112622745"
     variation       1653
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183840358"
     variation       1706
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:41414147"
     variation       1779
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143589063"
     variation       1915
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369515918"
     variation       2036
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145725153"
     variation       2068
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373926603"
     variation       2109
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41495153"
     variation       2115
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142957506"
     variation       2133
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151122728"
     variation       2153
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375306827"
     variation       2180
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17765882"
     variation       2200
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41418945"
     variation       2203
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41466044"
     variation       2225
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190456231"
     variation       2360
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41345848"
     variation       2362
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141257116"
     variation       2386
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200501663"
     variation       2402
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201290180"
     variation       2406
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199648605"
     variation       2434
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800874"
     variation       2444
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200364389"
     variation       2460
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201423367"
     variation       2472
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186889269"
     variation       2507
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146926765"
     variation       2562
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:137866928"
     variation       2582
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41535253"
     variation       2650
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41526948"
     variation       2662
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77024144"
     variation       2814
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201417500"
     variation       2815
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3188094"
     variation       2819
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190094030"
     variation       2843
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181602248"
     variation       2847
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185327310"
     variation       2929
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1048115"
     variation       3022
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:141737357"
     variation       3033
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:41442546"
     variation       3130
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190136403"
     variation       3136
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376306118"
     variation       3188
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182052831"
     variation       3195
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:41512547"
     variation       3276
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746492"
     variation       3278
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200688955"
     variation       3290
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186138215"
     variation       3304
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:192256035"
     variation       3446
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184040468"
     variation       3462
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370386700"
     variation       3489
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188577829"
     variation       3534
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374785441"
     polyA_signal    3638..3643
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
     polyA_site      3661
                     /gene="CCR5"
                     /gene_synonym="CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5;
                     CKR5; CMKBR5; IDDM22"
ORIGIN      
cttcagatagattatatctggagtgaagaatcctgccacctatgtatctggcatagtattctgtgtagtgggatgagcagagaacaaaaacaaaataatccagtgagaaaagcccgtaaataaaccttcagaccagagatctattctctagcttattttaagctcaacttaaaaagaagaactgttctctgattcttttcgccttcaatacacttaatgatttaactccaccctccttcaaaagaaacagcatttcctacttttatactgtctatatgattgatttgcacagctcatctggccagaagagctgagacatccgttcccctacaagaaactctccccgggtggaacaagatggattatcaagtgtcaagtccaatctatgacatcaattattatacatcggagccctgccaaaaaatcaatgtgaagcaaatcgcagcccgcctcctgcctccgctctactcactggtgttcatctttggttttgtgggcaacatgctggtcatcctcatcctgataaactgcaaaaggctgaagagcatgactgacatctacctgctcaacctggccatctctgacctgtttttccttcttactgtccccttctgggctcactatgctgccgcccagtgggactttggaaatacaatgtgtcaactcttgacagggctctattttataggcttcttctctggaatcttcttcatcatcctcctgacaatcgataggtacctggctgtcgtccatgctgtgtttgctttaaaagccaggacggtcacctttggggtggtgacaagtgtgatcacttgggtggtggctgtgtttgcgtctctcccaggaatcatctttaccagatctcaaaaagaaggtcttcattacacctgcagctctcattttccatacagtcagtatcaattctggaagaatttccagacattaaagatagtcatcttggggctggtcctgccgctgcttgtcatggtcatctgctactcgggaatcctaaaaactctgcttcggtgtcgaaatgagaagaagaggcacagggctgtgaggcttatcttcaccatcatgattgtttattttctcttctgggctccctacaacattgtccttctcctgaacaccttccaggaattctttggcctgaataattgcagtagctctaacaggttggaccaagctatgcaggtgacagagactcttgggatgacgcactgctgcatcaaccccatcatctatgcctttgtcggggagaagttcagaaactacctcttagtcttcttccaaaagcacattgccaaacgcttctgcaaatgctgttctattttccagcaagaggctcccgagcgagcaagctcagtttacacccgatccactggggagcaggaaatatctgtgggcttgtgacacggactcaagtgggctggtgacccagtcagagttgtgcacatggcttagttttcatacacagcctgggctgggggtggggtgggagaggtcttttttaaaaggaagttactgttatagagggtctaagattcatccatttatttggcatctgtttaaagtagattagatcttttaagcccatcaattatagaaagccaaatcaaaatatgttgatgaaaaatagcaacctttttatctccccttcacatgcatcaagttattgacaaactctcccttcactccgaaagttccttatgtatatttaaaagaaagcctcagagaattgctgattcttgagtttagtgatctgaacagaaataccaaaattatttcagaaatgtacaactttttacctagtacaaggcaacatataggttgtaaatgtgtttaaaacaggtctttgtcttgctatggggagaaaagacatgaatatgattagtaaagaaatgacacttttcatgtgtgatttcccctccaaggtatggttaataagtttcactgacttagaaccaggcgagagacttgtggcctgggagagctggggaagcttcttaaatgagaaggaatttgagttggatcatctattgctggcaaagacagaagcctcactgcaagcactgcatgggcaagcttggctgtagaaggagacagagctggttgggaagacatggggaggaaggacaaggctagatcatgaagaaccttgacggcattgctccgtctaagtcatgagctgagcagggagatcctggttggtgttgcagaaggtttactctgtggccaaaggagggtcaggaaggatgagcatttagggcaaggagaccaccaacagccctcaggtcagggtgaggatggcctctgctaagctcaaggcgtgaggatgggaaggagggaggtattcgtaaggatgggaaggagggaggtattcgtgcagcatatgaggatgcagagtcagcagaactggggtggatttgggttggaagtgagggtcagagaggagtcagagagaatccctagtcttcaagcagattggagaaacccttgaaaagacatcaagcacagaaggaggaggaggaggtttaggtcaagaagaagatggattggtgtaaaaggatgggtctggtttgcagagcttgaacacagtctcacccagactccaggctgtctttcactgaatgcttctgacttcatagatttccttcccatcccagctgaaatactgaggggtctccaggaggagactagatttatgaatacacgaggtatgaggtctaggaacatacttcagctcacacatgagatctaggtgaggattgattacctagtagtcatttcatgggttgttgggaggattctatgaggcaaccacaggcagcatttagcacatactacacattcaataagcatcaaactcttagttactcattcagggatagcactgagcaaagcattgagcaaaggggtcccatagaggtgagggaagcctgaaaaactaagatgctgcctgcccagtgcacacaagtgtaggtatcattttctgcatttaaccgtcaataggcaaaggggggaagggacatattcatttggaaataagctgccttgagccttaaaacccacaaaagtacaatttaccagcctccgtatttcagactgaatgggggtggggggggcgccttaggtacttattccagatgccttctccagacaaaccagaagcaacagaaaaaatcgtctctccctccctttgaaatgaatataccccttagtgtttgggtatattcatttcaaagggagagagagaggtttttttctgttctgtctcatatgattgtgcacatacttgagactgttttgaatttgggggatggctaaaaccatcatagtacaggtaaggtgagggaatagtaagtggtgagaactactcagggaatgaaggtgtcagaataataagaggtgctactgactttctcagcctctgaatatgaacggtgagcattgtggctgtcagcaggaagcaacgaagggaaatgtctttccttttgctcttaagttgtggagagtgcaacagtagcataggaccctaccctctgggccaagtcaaagacattctgacatcttagtatttgcatattcttatgtatgtgaaagttacaaattgcttgaaagaaaatatgcatctaataaaaaacaccttctaaaataaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1234 -> Molecular function: GO:0003779 [actin binding] evidence: IDA
            GeneID:1234 -> Molecular function: GO:0004435 [phosphatidylinositol phospholipase C activity] evidence: TAS
            GeneID:1234 -> Molecular function: GO:0004950 [chemokine receptor activity] evidence: TAS
            GeneID:1234 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:1234 -> Molecular function: GO:0015026 [coreceptor activity] evidence: TAS
            GeneID:1234 -> Molecular function: GO:0016493 [C-C chemokine receptor activity] evidence: IDA
            GeneID:1234 -> Molecular function: GO:0016493 [C-C chemokine receptor activity] evidence: NAS
            GeneID:1234 -> Molecular function: GO:0019957 [C-C chemokine binding] evidence: IPI
            GeneID:1234 -> Molecular function: GO:0071791 [chemokine (C-C motif) ligand 5 binding] evidence: IPI
            GeneID:1234 -> Biological process: GO:0000165 [MAPK cascade] evidence: IEP
            GeneID:1234 -> Biological process: GO:0002407 [dendritic cell chemotaxis] evidence: TAS
            GeneID:1234 -> Biological process: GO:0006816 [calcium ion transport] evidence: IDA
            GeneID:1234 -> Biological process: GO:0006935 [chemotaxis] evidence: TAS
            GeneID:1234 -> Biological process: GO:0006954 [inflammatory response] evidence: IEA
            GeneID:1234 -> Biological process: GO:0006955 [immune response] evidence: IEA
            GeneID:1234 -> Biological process: GO:0006968 [cellular defense response] evidence: TAS
            GeneID:1234 -> Biological process: GO:0007166 [cell surface receptor signaling pathway] evidence: TAS
            GeneID:1234 -> Biological process: GO:0007186 [G-protein coupled receptor signaling pathway] evidence: IMP
            GeneID:1234 -> Biological process: GO:0007204 [elevation of cytosolic calcium ion concentration] evidence: TAS
            GeneID:1234 -> Biological process: GO:0007267 [cell-cell signaling] evidence: IDA
            GeneID:1234 -> Biological process: GO:0014808 [release of sequestered calcium ion into cytosol by sarcoplasmic reticulum] evidence: IDA
            GeneID:1234 -> Biological process: GO:0016032 [viral process] evidence: TAS
            GeneID:1234 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
            GeneID:1234 -> Biological process: GO:0019722 [calcium-mediated signaling] evidence: IDA
            GeneID:1234 -> Biological process: GO:0023052 [signaling] evidence: IEP
            GeneID:1234 -> Biological process: GO:0030260 [entry into host cell] evidence: TAS
            GeneID:1234 -> Biological process: GO:0070098 [chemokine-mediated signaling pathway] evidence: TAS
            GeneID:1234 -> Biological process: GO:0070723 [response to cholesterol] evidence: IMP
            GeneID:1234 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IEP
            GeneID:1234 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
            GeneID:1234 -> Cellular component: GO:0005768 [endosome] evidence: IDA
            GeneID:1234 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
            GeneID:1234 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
            GeneID:1234 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IDA
            GeneID:1234 -> Cellular component: GO:0009986 [cell surface] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.