2024-04-26 12:52:25, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000450 3875 bp mRNA linear PRI 01-JUL-2013 DEFINITION Homo sapiens selectin E (SELE), mRNA. ACCESSION NM_000450 VERSION NM_000450.2 GI:187960041 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3875) AUTHORS Roth Flach,R.J., Matevossian,A., Akie,T.E., Negrin,K.A., Paul,M.T. and Czech,M.P. TITLE beta3-Adrenergic receptor stimulation induces E-selectin-mediated adipose tissue inflammation JOURNAL J. Biol. Chem. 288 (4), 2882-2892 (2013) PUBMED 23235150 REMARK GeneRIF: beta(3)-adrenergic stimulation acts through up-regulation of E-selectin in adipose tissue endothelial cells to induce neutrophil infiltration REFERENCE 2 (bases 1 to 3875) AUTHORS Rebholz,C.M., Reynolds,K., Wofford,M.R., Chen,J., Kelly,T.N., Mei,H., Whelton,P.K. and He,J. TITLE Effect of soybean protein on novel cardiovascular disease risk factors: a randomized controlled trial JOURNAL Eur J Clin Nutr 67 (1), 58-63 (2013) PUBMED 23187956 REMARK GeneRIF: Data suggest that plasma E-selectin and leptin can be down-regulated by dietary changes; soy protein supplementation appears to reduce plasma levels of E-selectin and leptin. REFERENCE 3 (bases 1 to 3875) AUTHORS Kontogianni,P., Zambirinis,C.P., Theodoropoulos,G., Gazouli,M., Michalopoulos,N.V., Flessas,J., Liberi,M. and Zografos,G.C. TITLE The impact of the stromal cell-derived factor-1-3'A and E-selectin S128R polymorphisms on breast cancer JOURNAL Mol. Biol. Rep. 40 (1), 43-50 (2013) PUBMED 23129313 REMARK GeneRIF: SDF-1-3'A confers increased susceptibility to breast cancer and that the E-selectin S128R CC genotype may be related to poorer prognosis. REFERENCE 4 (bases 1 to 3875) AUTHORS Smadja,D.M., Mulliken,J.B. and Bischoff,J. TITLE E-selectin mediates stem cell adhesion and formation of blood vessels in a murine model of infantile hemangioma JOURNAL Am. J. Pathol. 181 (6), 2239-2247 (2012) PUBMED 23041613 REMARK GeneRIF: Constitutively expressed E-selectin on endothelial cells in the proliferating phase is one mediator of the stem cell tropism in infantile hemangioma. REFERENCE 5 (bases 1 to 3875) AUTHORS Wu,S., Hsu,L.A., Teng,M.S., Lin,J.F., Chang,H.H., Sun,Y.C., Chen,H.P. and Ko,Y.L. TITLE Association of SELE genotypes/haplotypes with sE-selectin levels in Taiwanese individuals: interactive effect of MMP9 level JOURNAL BMC Med. Genet. 13, 115 (2012) PUBMED 23190470 REMARK GeneRIF: The associations of SELE genotypes/haplotypes with sE-selectin levels are affected by MMP9 levels in Taiwanese individuals. Publication Status: Online-Only REFERENCE 6 (bases 1 to 3875) AUTHORS Ryan,U.S. and Worthington,R.E. TITLE Cell-cell contact mechanisms JOURNAL Curr. Opin. Immunol. 4 (1), 33-37 (1992) PUBMED 1375831 REMARK Review article REFERENCE 7 (bases 1 to 3875) AUTHORS Collins,T., Williams,A., Johnston,G.I., Kim,J., Eddy,R., Shows,T., Gimbrone,M.A. Jr. and Bevilacqua,M.P. TITLE Structure and chromosomal location of the gene for endothelial-leukocyte adhesion molecule 1 JOURNAL J. Biol. Chem. 266 (4), 2466-2473 (1991) PUBMED 1703529 REFERENCE 8 (bases 1 to 3875) AUTHORS Phillips,M.L., Nudelman,E., Gaeta,F.C., Perez,M., Singhal,A.K., Hakomori,S. and Paulson,J.C. TITLE ELAM-1 mediates cell adhesion by recognition of a carbohydrate ligand, sialyl-Lex JOURNAL Science 250 (4984), 1130-1132 (1990) PUBMED 1701274 REFERENCE 9 (bases 1 to 3875) AUTHORS Watson,M.L., Kingsmore,S.F., Johnston,G.I., Siegelman,M.H., Le Beau,M.M., Lemons,R.S., Bora,N.S., Howard,T.A., Weissman,I.L., McEver,R.P. et al. TITLE Genomic organization of the selectin family of leukocyte adhesion molecules on human and mouse chromosome 1 JOURNAL J. Exp. Med. 172 (1), 263-272 (1990) PUBMED 1694218 REFERENCE 10 (bases 1 to 3875) AUTHORS Hession,C., Osborn,L., Goff,D., Chi-Rosso,G., Vassallo,C., Pasek,M., Pittack,C., Tizard,R., Goelz,S., McCarthy,K. et al. TITLE Endothelial leukocyte adhesion molecule 1: direct expression cloning and functional interactions JOURNAL Proc. Natl. Acad. Sci. U.S.A. 87 (5), 1673-1677 (1990) PUBMED 1689848 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DB209354.1 and BC142711.1. This sequence is a reference standard in the RefSeqGene project. On May 13, 2008 this sequence version replaced gi:4506870. Summary: The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC142677.1, M30640.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-13 DB209354.1 1-13 14-3875 BC142711.1 1-3862 FEATURES Location/Qualifiers source 1..3875 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1q22-q25" gene 1..3875 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="selectin E" /db_xref="GeneID:6401" /db_xref="HGNC:10718" /db_xref="MIM:131210" exon 1..109 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" variation 37 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="g" /db_xref="dbSNP:3917397" misc_feature 44..46 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="upstream in-frame stop codon" variation 59 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="g" /db_xref="dbSNP:3917398" exon 110..194 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" variation 139 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="g" /replace="t" /db_xref="dbSNP:1805193" CDS 158..1990 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="leukocyte endothelial cell adhesion molecule 2; endothelial adhesion molecule 1; E-selectin; ELAM-1; CD62 antigen-like family member E; endothelial leukocyte adhesion molecule 1; leukocyte-endothelial cell adhesion molecule 2" /codon_start=1 /product="E-selectin precursor" /protein_id="NP_000441.2" /db_xref="GI:187960042" /db_xref="CCDS:CCDS1283.1" /db_xref="GeneID:6401" /db_xref="HGNC:10718" /db_xref="MIM:131210" /translation="
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
" sig_peptide 158..220 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 221..1987 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /product="E-selectin" misc_feature 221..577 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="C-type lectin-like domain (CTLD) of the type found in the type 1 transmembrane proteins: P(platlet)-, E(endothelial)-, and L(leukocyte)- selectins (sels); Region: CLECT_selectins_like; cd03592" /db_xref="CDD:153062" misc_feature order(362..364,458..460,464..469,494..496,500..502, 533..541) /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="carbohydrate binding site [chemical binding]; other site" /db_xref="CDD:153062" misc_feature order(362..364,458..460,464..466,482..484,494..496, 500..502,533..541) /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="PSGL-1 peptide binding surface; other site" /db_xref="CDD:153062" misc_feature 587..682 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:28936" misc_feature 695..868 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system; Region: CCP; cd00033" /db_xref="CDD:153056" misc_feature order(725..727,788..790) /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="receptor-ligand interactions; other site" /db_xref="CDD:153056" misc_feature 881..1057 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system; Region: CCP; cd00033" /db_xref="CDD:153056" misc_feature order(911..913,974..976) /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="receptor-ligand interactions; other site" /db_xref="CDD:153056" misc_feature 1067..1246 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system; Region: CCP; cd00033" /db_xref="CDD:153056" misc_feature order(1097..1099,1163..1165) /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="receptor-ligand interactions; other site" /db_xref="CDD:153056" misc_feature 1256..1435 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system; Region: CCP; cd00033" /db_xref="CDD:153056" misc_feature order(1286..1288,1352..1354) /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="receptor-ligand interactions; other site" /db_xref="CDD:153056" misc_feature 1445..1624 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system; Region: CCP; cd00033" /db_xref="CDD:153056" misc_feature order(1475..1477,1541..1543) /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="receptor-ligand interactions; other site" /db_xref="CDD:153056" misc_feature 1634..1801 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system; Region: CCP; cd00033" /db_xref="CDD:153056" misc_feature order(1664..1666,1718..1720) /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /note="receptor-ligand interactions; other site" /db_xref="CDD:153056" misc_feature 1826..1891 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P16581.1); transmembrane region" exon 195..578 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" variation 218 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="g" /replace="t" /db_xref="dbSNP:3917407" variation 250 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="g" /replace="t" /db_xref="dbSNP:3917408" STS 423..677 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /standard_name="PMC97258P1" /db_xref="UniSTS:273644" variation 430 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="g" /db_xref="dbSNP:1800015" variation 433 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="g" /db_xref="dbSNP:1800016" variation 547 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="g" /db_xref="dbSNP:5360" exon 579..686 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" variation 602 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="c" /db_xref="dbSNP:5361" exon 687..872 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" exon 873..1058 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" variation 898 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="t" /db_xref="dbSNP:5363" variation 927 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="c" /db_xref="dbSNP:3917422" variation 1030 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="t" /db_xref="dbSNP:3917455" variation 1040 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="g" /db_xref="dbSNP:5364" exon 1059..1247 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" exon 1248..1436 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" variation 1417 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="t" /db_xref="dbSNP:5365" variation 1418 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="g" /db_xref="dbSNP:5366" exon 1437..1625 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" exon 1626..1802 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" exon 1803..1910 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" variation 1805 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="t" /db_xref="dbSNP:3917429" variation 1846 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="t" /db_xref="dbSNP:1800017" variation 1880 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="t" /db_xref="dbSNP:5355" exon 1911..1932 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" exon 1933..2005 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" variation 1957 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="t" /db_xref="dbSNP:5356" variation 1978 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="t" /db_xref="dbSNP:1800018" exon 2006..3875 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /inference="alignment:Splign:1.39.8" STS 2086..2560 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /standard_name="D1S332" /db_xref="UniSTS:148053" variation 2196 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="t" /db_xref="dbSNP:13306827" STS 2220..2338 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /standard_name="D1S3363" /db_xref="UniSTS:41618" variation 2350 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="g" /db_xref="dbSNP:13306828" variation 2943 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="t" /db_xref="dbSNP:5357" variation 2980 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="g" /replace="t" /db_xref="dbSNP:5358" variation 3134 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="g" /db_xref="dbSNP:5359" STS 3410..3572 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /standard_name="RH17688" /db_xref="UniSTS:29198" variation 3524 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="a" /replace="g" /db_xref="dbSNP:4786" variation 3535 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" /replace="c" /replace="g" /db_xref="dbSNP:3917441" polyA_signal 3856..3861 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" polyA_site 3875 /gene="SELE" /gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2" ORIGIN
agctgttcttggctgacttcacatcaaaactcctatactgacctgagacagaggcagcagtgatacccacctgagagatcctgtgtttgaacaactgcttcccaaaacggaaagtatttcaagcctaaacctttgggtgaaaagaactcttgaagtcatgattgcttcacagtttctctcagctctcactttggtgcttctcattaaagagagtggagcctggtcttacaacacctccacggaagctatgacttatgatgaggccagtgcttattgtcagcaaaggtacacacacctggttgcaattcaaaacaaagaagagattgagtacctaaactccatattgagctattcaccaagttattactggattggaatcagaaaagtcaacaatgtgtgggtctgggtaggaacccagaaacctctgacagaagaagccaagaactgggctccaggtgaacccaacaataggcaaaaagatgaggactgcgtggagatctacatcaagagagaaaaagatgtgggcatgtggaatgatgagaggtgcagcaagaagaagcttgccctatgctacacagctgcctgtaccaatacatcctgcagtggccacggtgaatgtgtagagaccatcaataattacacttgcaagtgtgaccctggcttcagtggactcaagtgtgagcaaattgtgaactgtacagccctggaatcccctgagcatggaagcctggtttgcagtcacccactgggaaacttcagctacaattcttcctgctctatcagctgtgataggggttacctgccaagcagcatggagaccatgcagtgtatgtcctctggagaatggagtgctcctattccagcctgcaatgtggttgagtgtgatgctgtgacaaatccagccaatgggttcgtggaatgtttccaaaaccctggaagcttcccatggaacacaacctgtacatttgactgtgaagaaggatttgaactaatgggagcccagagccttcagtgtacctcatctgggaattgggacaacgagaagccaacgtgtaaagctgtgacatgcagggccgtccgccagcctcagaatggctctgtgaggtgcagccattcccctgctggagagttcaccttcaaatcatcctgcaacttcacctgtgaggaaggcttcatgttgcagggaccagcccaggttgaatgcaccactcaagggcagtggacacagcaaatcccagtttgtgaagctttccagtgcacagccttgtccaaccccgagcgaggctacatgaattgtcttcctagtgcttctggcagtttccgttatgggtccagctgtgagttctcctgtgagcagggttttgtgttgaagggatccaaaaggctccaatgtggccccacaggggagtgggacaacgagaagcccacatgtgaagctgtgagatgcgatgctgtccaccagcccccgaagggtttggtgaggtgtgctcattcccctattggagaattcacctacaagtcctcttgtgccttcagctgtgaggagggatttgaattacatggatcaactcaacttgagtgcacatctcagggacaatggacagaagaggttccttcctgccaagtggtaaaatgttcaagcctggcagttccgggaaagatcaacatgagctgcagtggggagcccgtgtttggcactgtgtgcaagttcgcctgtcctgaaggatggacgctcaatggctctgcagctcggacatgtggagccacaggacactggtctggcctgctacctacctgtgaagctcccactgagtccaacattcccttggtagctggactttctgctgctggactctccctcctgacattagcaccatttctcctctggcttcggaaatgcttacggaaagcaaagaaatttgttcctgccagcagctgccaaagccttgaatcagatggaagctaccaaaagccttcttacatcctttaagttcaaaagaatcagaaacaggtgcatctggggaactagagggatacactgaagttaacagagacagataactctcctcgggtctctggcccttcttgcctactatgccagatgcctttatggctgaaaccgcaacacccatcaccacttcaatagatcaaagtccagcaggcaaggacggccttcaactgaaaagactcagtgttccctttcctactctcaggatcaagaaagtgttggctaatgaagggaaaggatattttcttccaagcaaaggtgaagagaccaagactctgaaatctcagaattccttttctaactctcccttgctcgctgtaaaatcttggcacagaaacacaatattttgtggctttctttcttttgcccttcacagtgtttcgacagctgattacacagttgctgtcataagaatgaataataattatccagagtttagaggaaaaaaatgactaaaaatattataacttaaaaaaatgacagatgttgaatgcccacaggcaaatgcatggagggttgttaatggtgcaaatcctactgaatgctctgtgcgagggttactatgcacaatttaatcactttcatccctatgggattcagtgcttcttaaagagttcttaaggattgtgatatttttacttgcattgaatatattataatcttccatacttcttcattcaatacaagtgtggtagggacttaaaaaacttgtaaatgctgtcaactatgatatggtaaaagttacttattctagattaccccctcattgtttattaacaaattatgttacatctgttttaaatttatttcaaaaagggaaactattgtcccctagcaaggcatgatgttaaccagaataaagttctgagtgtttttactacagttgttttttgaaaacatggtagaattggagagtaaaaactgaatggaaggtttgtatattgtcagatattttttcagaaatatgtggtttccacgatgaaaaacttccatgaggccaaacgttttgaactaataaaagcataaatgcaaacacacaaaggtataattttatgaatgtctttgttggaaaagaatacagaaagatggatgtgctttgcattcctacaaagatgtttgtcagatatgatatgtaaacataattcttgtatattatggaagattttaaattcacaatagaaactcaccatgtaaaagagtcatctggtagatttttaacgaatgaagatgtctaatagttattccctatttgttttcttctgtatgttagggtgctctggaagagaggaatgcctgtgtgagcaagcatttatgtttatttataagcagatttaacaattccaaaggaatctccagttttcagttgatcactggcaatgaaaaattctcagtcagtaattgccaaagctgctctagccttgaggagtgtgagaatcaaaactctcctacacttccattaacttagcatgtgttgaaaaaaaagtttcagagaagttctggctgaacactggcaacaacaaagccaacagtcaaaacagagatgtgataaggatcagaacagcagaggttcttttaaaggggcagaaaaactctgggaaataagagagaacaactactgtgatcaggctatgtatggaatacagtgttattttctttgaaattgtttaagtgttgtaaatatttatgtaaactgcattagaaattagctgtgtgaaataccagtgtggtttgtgtttgagttttattgagaattttaaattataacttaaaatattttataatttttaaagtatatatttatttaagcttatgtcagacctatttgacataacactataaaggttgacaataaatgtgcttatgttta
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:6401 -> Molecular function: GO:0004888 [transmembrane signaling receptor activity] evidence: IMP GeneID:6401 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:6401 -> Molecular function: GO:0033691 [sialic acid binding] evidence: IDA GeneID:6401 -> Molecular function: GO:0043274 [phospholipase binding] evidence: IDA GeneID:6401 -> Molecular function: GO:0070492 [oligosaccharide binding] evidence: IDA GeneID:6401 -> Biological process: GO:0002092 [positive regulation of receptor internalization] evidence: IDA GeneID:6401 -> Biological process: GO:0002523 [leukocyte migration involved in inflammatory response] evidence: TAS GeneID:6401 -> Biological process: GO:0002687 [positive regulation of leukocyte migration] evidence: IEA GeneID:6401 -> Biological process: GO:0006954 [inflammatory response] evidence: TAS GeneID:6401 -> Biological process: GO:0007157 [heterophilic cell-cell adhesion] evidence: IMP GeneID:6401 -> Biological process: GO:0007159 [leukocyte cell-cell adhesion] evidence: IDA GeneID:6401 -> Biological process: GO:0007202 [activation of phospholipase C activity] evidence: IMP GeneID:6401 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS GeneID:6401 -> Biological process: GO:0019722 [calcium-mediated signaling] evidence: TAS GeneID:6401 -> Biological process: GO:0030029 [actin filament-based process] evidence: IDA GeneID:6401 -> Biological process: GO:0032496 [response to lipopolysaccharide] evidence: TAS GeneID:6401 -> Biological process: GO:0034612 [response to tumor necrosis factor] evidence: TAS GeneID:6401 -> Biological process: GO:0050727 [regulation of inflammatory response] evidence: TAS GeneID:6401 -> Biological process: GO:0050900 [leukocyte migration] evidence: TAS GeneID:6401 -> Biological process: GO:0050901 [leukocyte tethering or rolling] evidence: IMP GeneID:6401 -> Biological process: GO:0070555 [response to interleukin-1] evidence: IDA GeneID:6401 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA GeneID:6401 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS GeneID:6401 -> Cellular component: GO:0005901 [caveola] evidence: IDA GeneID:6401 -> Cellular component: GO:0005905 [coated pit] evidence: IDA GeneID:6401 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA GeneID:6401 -> Cellular component: GO:0030863 [cortical cytoskeleton] evidence: IDA GeneID:6401 -> Cellular component: GO:0045121 [membrane raft] evidence: IDA GeneID:6401 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.