Home |
Help |
Advanced search
2024-04-26 12:52:25, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000450 3875 bp mRNA linear PRI 01-JUL-2013
DEFINITION Homo sapiens selectin E (SELE), mRNA.
ACCESSION NM_000450
VERSION NM_000450.2 GI:187960041
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3875)
AUTHORS Roth Flach,R.J., Matevossian,A., Akie,T.E., Negrin,K.A., Paul,M.T.
and Czech,M.P.
TITLE beta3-Adrenergic receptor stimulation induces E-selectin-mediated
adipose tissue inflammation
JOURNAL J. Biol. Chem. 288 (4), 2882-2892 (2013)
PUBMED 23235150
REMARK GeneRIF: beta(3)-adrenergic stimulation acts through up-regulation
of E-selectin in adipose tissue endothelial cells to induce
neutrophil infiltration
REFERENCE 2 (bases 1 to 3875)
AUTHORS Rebholz,C.M., Reynolds,K., Wofford,M.R., Chen,J., Kelly,T.N.,
Mei,H., Whelton,P.K. and He,J.
TITLE Effect of soybean protein on novel cardiovascular disease risk
factors: a randomized controlled trial
JOURNAL Eur J Clin Nutr 67 (1), 58-63 (2013)
PUBMED 23187956
REMARK GeneRIF: Data suggest that plasma E-selectin and leptin can be
down-regulated by dietary changes; soy protein supplementation
appears to reduce plasma levels of E-selectin and leptin.
REFERENCE 3 (bases 1 to 3875)
AUTHORS Kontogianni,P., Zambirinis,C.P., Theodoropoulos,G., Gazouli,M.,
Michalopoulos,N.V., Flessas,J., Liberi,M. and Zografos,G.C.
TITLE The impact of the stromal cell-derived factor-1-3'A and E-selectin
S128R polymorphisms on breast cancer
JOURNAL Mol. Biol. Rep. 40 (1), 43-50 (2013)
PUBMED 23129313
REMARK GeneRIF: SDF-1-3'A confers increased susceptibility to breast
cancer and that the E-selectin S128R CC genotype may be related to
poorer prognosis.
REFERENCE 4 (bases 1 to 3875)
AUTHORS Smadja,D.M., Mulliken,J.B. and Bischoff,J.
TITLE E-selectin mediates stem cell adhesion and formation of blood
vessels in a murine model of infantile hemangioma
JOURNAL Am. J. Pathol. 181 (6), 2239-2247 (2012)
PUBMED 23041613
REMARK GeneRIF: Constitutively expressed E-selectin on endothelial cells
in the proliferating phase is one mediator of the stem cell tropism
in infantile hemangioma.
REFERENCE 5 (bases 1 to 3875)
AUTHORS Wu,S., Hsu,L.A., Teng,M.S., Lin,J.F., Chang,H.H., Sun,Y.C.,
Chen,H.P. and Ko,Y.L.
TITLE Association of SELE genotypes/haplotypes with sE-selectin levels in
Taiwanese individuals: interactive effect of MMP9 level
JOURNAL BMC Med. Genet. 13, 115 (2012)
PUBMED 23190470
REMARK GeneRIF: The associations of SELE genotypes/haplotypes with
sE-selectin levels are affected by MMP9 levels in Taiwanese
individuals.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 3875)
AUTHORS Ryan,U.S. and Worthington,R.E.
TITLE Cell-cell contact mechanisms
JOURNAL Curr. Opin. Immunol. 4 (1), 33-37 (1992)
PUBMED 1375831
REMARK Review article
REFERENCE 7 (bases 1 to 3875)
AUTHORS Collins,T., Williams,A., Johnston,G.I., Kim,J., Eddy,R., Shows,T.,
Gimbrone,M.A. Jr. and Bevilacqua,M.P.
TITLE Structure and chromosomal location of the gene for
endothelial-leukocyte adhesion molecule 1
JOURNAL J. Biol. Chem. 266 (4), 2466-2473 (1991)
PUBMED 1703529
REFERENCE 8 (bases 1 to 3875)
AUTHORS Phillips,M.L., Nudelman,E., Gaeta,F.C., Perez,M., Singhal,A.K.,
Hakomori,S. and Paulson,J.C.
TITLE ELAM-1 mediates cell adhesion by recognition of a carbohydrate
ligand, sialyl-Lex
JOURNAL Science 250 (4984), 1130-1132 (1990)
PUBMED 1701274
REFERENCE 9 (bases 1 to 3875)
AUTHORS Watson,M.L., Kingsmore,S.F., Johnston,G.I., Siegelman,M.H., Le
Beau,M.M., Lemons,R.S., Bora,N.S., Howard,T.A., Weissman,I.L.,
McEver,R.P. et al.
TITLE Genomic organization of the selectin family of leukocyte adhesion
molecules on human and mouse chromosome 1
JOURNAL J. Exp. Med. 172 (1), 263-272 (1990)
PUBMED 1694218
REFERENCE 10 (bases 1 to 3875)
AUTHORS Hession,C., Osborn,L., Goff,D., Chi-Rosso,G., Vassallo,C.,
Pasek,M., Pittack,C., Tizard,R., Goelz,S., McCarthy,K. et al.
TITLE Endothelial leukocyte adhesion molecule 1: direct expression
cloning and functional interactions
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 87 (5), 1673-1677 (1990)
PUBMED 1689848
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DB209354.1 and BC142711.1.
This sequence is a reference standard in the RefSeqGene project.
On May 13, 2008 this sequence version replaced gi:4506870.
Summary: The protein encoded by this gene is found in
cytokine-stimulated endothelial cells and is thought to be
responsible for the accumulation of blood leukocytes at sites of
inflammation by mediating the adhesion of cells to the vascular
lining. It exhibits structural features such as the presence of
lectin- and EGF-like domains followed by short consensus repeat
(SCR) domains that contain 6 conserved cysteine residues. These
proteins are part of the selectin family of cell adhesion
molecules. Adhesion molecules participate in the interaction
between leukocytes and the endothelium and appear to be involved in
the pathogenesis of atherosclerosis. [provided by RefSeq, Jul
2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC142677.1, M30640.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-13 DB209354.1 1-13
14-3875 BC142711.1 1-3862
FEATURES Location/Qualifiers
source 1..3875
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q22-q25"
gene 1..3875
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="selectin E"
/db_xref="GeneID:6401"
/db_xref="HGNC:10718"
/db_xref="MIM:131210"
exon 1..109
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
variation 37
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="g"
/db_xref="dbSNP:3917397"
misc_feature 44..46
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="upstream in-frame stop codon"
variation 59
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="g"
/db_xref="dbSNP:3917398"
exon 110..194
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
variation 139
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1805193"
CDS 158..1990
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="leukocyte endothelial cell adhesion molecule 2;
endothelial adhesion molecule 1; E-selectin; ELAM-1; CD62
antigen-like family member E; endothelial leukocyte
adhesion molecule 1; leukocyte-endothelial cell adhesion
molecule 2"
/codon_start=1
/product="E-selectin precursor"
/protein_id="NP_000441.2"
/db_xref="GI:187960042"
/db_xref="CCDS:CCDS1283.1"
/db_xref="GeneID:6401"
/db_xref="HGNC:10718"
/db_xref="MIM:131210"
/translation="
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
"
sig_peptide 158..220
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 221..1987
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/product="E-selectin"
misc_feature 221..577
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="C-type lectin-like domain (CTLD) of the type found
in the type 1 transmembrane proteins: P(platlet)-,
E(endothelial)-, and L(leukocyte)- selectins (sels);
Region: CLECT_selectins_like; cd03592"
/db_xref="CDD:153062"
misc_feature order(362..364,458..460,464..469,494..496,500..502,
533..541)
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="carbohydrate binding site [chemical binding]; other
site"
/db_xref="CDD:153062"
misc_feature order(362..364,458..460,464..466,482..484,494..496,
500..502,533..541)
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="PSGL-1 peptide binding surface; other site"
/db_xref="CDD:153062"
misc_feature 587..682
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="Calcium-binding EGF-like domain, present in a large
number of membrane-bound and extracellular (mostly animal)
proteins. Many of these proteins require calcium for their
biological function and calcium-binding sites have been
found to be located at the...; Region: EGF_CA; cd00054"
/db_xref="CDD:28936"
misc_feature 695..868
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="Complement control protein (CCP) modules (aka short
consensus repeats SCRs or SUSHI repeats) have been
identified in several proteins of the complement system;
Region: CCP; cd00033"
/db_xref="CDD:153056"
misc_feature order(725..727,788..790)
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="receptor-ligand interactions; other site"
/db_xref="CDD:153056"
misc_feature 881..1057
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="Complement control protein (CCP) modules (aka short
consensus repeats SCRs or SUSHI repeats) have been
identified in several proteins of the complement system;
Region: CCP; cd00033"
/db_xref="CDD:153056"
misc_feature order(911..913,974..976)
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="receptor-ligand interactions; other site"
/db_xref="CDD:153056"
misc_feature 1067..1246
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="Complement control protein (CCP) modules (aka short
consensus repeats SCRs or SUSHI repeats) have been
identified in several proteins of the complement system;
Region: CCP; cd00033"
/db_xref="CDD:153056"
misc_feature order(1097..1099,1163..1165)
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="receptor-ligand interactions; other site"
/db_xref="CDD:153056"
misc_feature 1256..1435
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="Complement control protein (CCP) modules (aka short
consensus repeats SCRs or SUSHI repeats) have been
identified in several proteins of the complement system;
Region: CCP; cd00033"
/db_xref="CDD:153056"
misc_feature order(1286..1288,1352..1354)
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="receptor-ligand interactions; other site"
/db_xref="CDD:153056"
misc_feature 1445..1624
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="Complement control protein (CCP) modules (aka short
consensus repeats SCRs or SUSHI repeats) have been
identified in several proteins of the complement system;
Region: CCP; cd00033"
/db_xref="CDD:153056"
misc_feature order(1475..1477,1541..1543)
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="receptor-ligand interactions; other site"
/db_xref="CDD:153056"
misc_feature 1634..1801
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="Complement control protein (CCP) modules (aka short
consensus repeats SCRs or SUSHI repeats) have been
identified in several proteins of the complement system;
Region: CCP; cd00033"
/db_xref="CDD:153056"
misc_feature order(1664..1666,1718..1720)
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/note="receptor-ligand interactions; other site"
/db_xref="CDD:153056"
misc_feature 1826..1891
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P16581.1);
transmembrane region"
exon 195..578
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
variation 218
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="g"
/replace="t"
/db_xref="dbSNP:3917407"
variation 250
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="g"
/replace="t"
/db_xref="dbSNP:3917408"
STS 423..677
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/standard_name="PMC97258P1"
/db_xref="UniSTS:273644"
variation 430
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1800015"
variation 433
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1800016"
variation 547
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="g"
/db_xref="dbSNP:5360"
exon 579..686
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
variation 602
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="c"
/db_xref="dbSNP:5361"
exon 687..872
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
exon 873..1058
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
variation 898
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="t"
/db_xref="dbSNP:5363"
variation 927
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="c"
/db_xref="dbSNP:3917422"
variation 1030
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="t"
/db_xref="dbSNP:3917455"
variation 1040
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="g"
/db_xref="dbSNP:5364"
exon 1059..1247
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
exon 1248..1436
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
variation 1417
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="t"
/db_xref="dbSNP:5365"
variation 1418
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="g"
/db_xref="dbSNP:5366"
exon 1437..1625
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
exon 1626..1802
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
exon 1803..1910
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
variation 1805
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="t"
/db_xref="dbSNP:3917429"
variation 1846
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1800017"
variation 1880
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="t"
/db_xref="dbSNP:5355"
exon 1911..1932
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
exon 1933..2005
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
variation 1957
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="t"
/db_xref="dbSNP:5356"
variation 1978
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1800018"
exon 2006..3875
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/inference="alignment:Splign:1.39.8"
STS 2086..2560
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/standard_name="D1S332"
/db_xref="UniSTS:148053"
variation 2196
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="t"
/db_xref="dbSNP:13306827"
STS 2220..2338
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/standard_name="D1S3363"
/db_xref="UniSTS:41618"
variation 2350
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="g"
/db_xref="dbSNP:13306828"
variation 2943
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="t"
/db_xref="dbSNP:5357"
variation 2980
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="g"
/replace="t"
/db_xref="dbSNP:5358"
variation 3134
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="g"
/db_xref="dbSNP:5359"
STS 3410..3572
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/standard_name="RH17688"
/db_xref="UniSTS:29198"
variation 3524
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="a"
/replace="g"
/db_xref="dbSNP:4786"
variation 3535
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
/replace="c"
/replace="g"
/db_xref="dbSNP:3917441"
polyA_signal 3856..3861
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
polyA_site 3875
/gene="SELE"
/gene_synonym="CD62E; ELAM; ELAM1; ESEL; LECAM2"
ORIGIN
agctgttcttggctgacttcacatcaaaactcctatactgacctgagacagaggcagcagtgatacccacctgagagatcctgtgtttgaacaactgcttcccaaaacggaaagtatttcaagcctaaacctttgggtgaaaagaactcttgaagtcatgattgcttcacagtttctctcagctctcactttggtgcttctcattaaagagagtggagcctggtcttacaacacctccacggaagctatgacttatgatgaggccagtgcttattgtcagcaaaggtacacacacctggttgcaattcaaaacaaagaagagattgagtacctaaactccatattgagctattcaccaagttattactggattggaatcagaaaagtcaacaatgtgtgggtctgggtaggaacccagaaacctctgacagaagaagccaagaactgggctccaggtgaacccaacaataggcaaaaagatgaggactgcgtggagatctacatcaagagagaaaaagatgtgggcatgtggaatgatgagaggtgcagcaagaagaagcttgccctatgctacacagctgcctgtaccaatacatcctgcagtggccacggtgaatgtgtagagaccatcaataattacacttgcaagtgtgaccctggcttcagtggactcaagtgtgagcaaattgtgaactgtacagccctggaatcccctgagcatggaagcctggtttgcagtcacccactgggaaacttcagctacaattcttcctgctctatcagctgtgataggggttacctgccaagcagcatggagaccatgcagtgtatgtcctctggagaatggagtgctcctattccagcctgcaatgtggttgagtgtgatgctgtgacaaatccagccaatgggttcgtggaatgtttccaaaaccctggaagcttcccatggaacacaacctgtacatttgactgtgaagaaggatttgaactaatgggagcccagagccttcagtgtacctcatctgggaattgggacaacgagaagccaacgtgtaaagctgtgacatgcagggccgtccgccagcctcagaatggctctgtgaggtgcagccattcccctgctggagagttcaccttcaaatcatcctgcaacttcacctgtgaggaaggcttcatgttgcagggaccagcccaggttgaatgcaccactcaagggcagtggacacagcaaatcccagtttgtgaagctttccagtgcacagccttgtccaaccccgagcgaggctacatgaattgtcttcctagtgcttctggcagtttccgttatgggtccagctgtgagttctcctgtgagcagggttttgtgttgaagggatccaaaaggctccaatgtggccccacaggggagtgggacaacgagaagcccacatgtgaagctgtgagatgcgatgctgtccaccagcccccgaagggtttggtgaggtgtgctcattcccctattggagaattcacctacaagtcctcttgtgccttcagctgtgaggagggatttgaattacatggatcaactcaacttgagtgcacatctcagggacaatggacagaagaggttccttcctgccaagtggtaaaatgttcaagcctggcagttccgggaaagatcaacatgagctgcagtggggagcccgtgtttggcactgtgtgcaagttcgcctgtcctgaaggatggacgctcaatggctctgcagctcggacatgtggagccacaggacactggtctggcctgctacctacctgtgaagctcccactgagtccaacattcccttggtagctggactttctgctgctggactctccctcctgacattagcaccatttctcctctggcttcggaaatgcttacggaaagcaaagaaatttgttcctgccagcagctgccaaagccttgaatcagatggaagctaccaaaagccttcttacatcctttaagttcaaaagaatcagaaacaggtgcatctggggaactagagggatacactgaagttaacagagacagataactctcctcgggtctctggcccttcttgcctactatgccagatgcctttatggctgaaaccgcaacacccatcaccacttcaatagatcaaagtccagcaggcaaggacggccttcaactgaaaagactcagtgttccctttcctactctcaggatcaagaaagtgttggctaatgaagggaaaggatattttcttccaagcaaaggtgaagagaccaagactctgaaatctcagaattccttttctaactctcccttgctcgctgtaaaatcttggcacagaaacacaatattttgtggctttctttcttttgcccttcacagtgtttcgacagctgattacacagttgctgtcataagaatgaataataattatccagagtttagaggaaaaaaatgactaaaaatattataacttaaaaaaatgacagatgttgaatgcccacaggcaaatgcatggagggttgttaatggtgcaaatcctactgaatgctctgtgcgagggttactatgcacaatttaatcactttcatccctatgggattcagtgcttcttaaagagttcttaaggattgtgatatttttacttgcattgaatatattataatcttccatacttcttcattcaatacaagtgtggtagggacttaaaaaacttgtaaatgctgtcaactatgatatggtaaaagttacttattctagattaccccctcattgtttattaacaaattatgttacatctgttttaaatttatttcaaaaagggaaactattgtcccctagcaaggcatgatgttaaccagaataaagttctgagtgtttttactacagttgttttttgaaaacatggtagaattggagagtaaaaactgaatggaaggtttgtatattgtcagatattttttcagaaatatgtggtttccacgatgaaaaacttccatgaggccaaacgttttgaactaataaaagcataaatgcaaacacacaaaggtataattttatgaatgtctttgttggaaaagaatacagaaagatggatgtgctttgcattcctacaaagatgtttgtcagatatgatatgtaaacataattcttgtatattatggaagattttaaattcacaatagaaactcaccatgtaaaagagtcatctggtagatttttaacgaatgaagatgtctaatagttattccctatttgttttcttctgtatgttagggtgctctggaagagaggaatgcctgtgtgagcaagcatttatgtttatttataagcagatttaacaattccaaaggaatctccagttttcagttgatcactggcaatgaaaaattctcagtcagtaattgccaaagctgctctagccttgaggagtgtgagaatcaaaactctcctacacttccattaacttagcatgtgttgaaaaaaaagtttcagagaagttctggctgaacactggcaacaacaaagccaacagtcaaaacagagatgtgataaggatcagaacagcagaggttcttttaaaggggcagaaaaactctgggaaataagagagaacaactactgtgatcaggctatgtatggaatacagtgttattttctttgaaattgtttaagtgttgtaaatatttatgtaaactgcattagaaattagctgtgtgaaataccagtgtggtttgtgtttgagttttattgagaattttaaattataacttaaaatattttataatttttaaagtatatatttatttaagcttatgtcagacctatttgacataacactataaaggttgacaataaatgtgcttatgttta
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:6401 -> Molecular function: GO:0004888 [transmembrane signaling receptor activity] evidence: IMP
GeneID:6401 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:6401 -> Molecular function: GO:0033691 [sialic acid binding] evidence: IDA
GeneID:6401 -> Molecular function: GO:0043274 [phospholipase binding] evidence: IDA
GeneID:6401 -> Molecular function: GO:0070492 [oligosaccharide binding] evidence: IDA
GeneID:6401 -> Biological process: GO:0002092 [positive regulation of receptor internalization] evidence: IDA
GeneID:6401 -> Biological process: GO:0002523 [leukocyte migration involved in inflammatory response] evidence: TAS
GeneID:6401 -> Biological process: GO:0002687 [positive regulation of leukocyte migration] evidence: IEA
GeneID:6401 -> Biological process: GO:0006954 [inflammatory response] evidence: TAS
GeneID:6401 -> Biological process: GO:0007157 [heterophilic cell-cell adhesion] evidence: IMP
GeneID:6401 -> Biological process: GO:0007159 [leukocyte cell-cell adhesion] evidence: IDA
GeneID:6401 -> Biological process: GO:0007202 [activation of phospholipase C activity] evidence: IMP
GeneID:6401 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS
GeneID:6401 -> Biological process: GO:0019722 [calcium-mediated signaling] evidence: TAS
GeneID:6401 -> Biological process: GO:0030029 [actin filament-based process] evidence: IDA
GeneID:6401 -> Biological process: GO:0032496 [response to lipopolysaccharide] evidence: TAS
GeneID:6401 -> Biological process: GO:0034612 [response to tumor necrosis factor] evidence: TAS
GeneID:6401 -> Biological process: GO:0050727 [regulation of inflammatory response] evidence: TAS
GeneID:6401 -> Biological process: GO:0050900 [leukocyte migration] evidence: TAS
GeneID:6401 -> Biological process: GO:0050901 [leukocyte tethering or rolling] evidence: IMP
GeneID:6401 -> Biological process: GO:0070555 [response to interleukin-1] evidence: IDA
GeneID:6401 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
GeneID:6401 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:6401 -> Cellular component: GO:0005901 [caveola] evidence: IDA
GeneID:6401 -> Cellular component: GO:0005905 [coated pit] evidence: IDA
GeneID:6401 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
GeneID:6401 -> Cellular component: GO:0030863 [cortical cytoskeleton] evidence: IDA
GeneID:6401 -> Cellular component: GO:0045121 [membrane raft] evidence: IDA
GeneID:6401 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.