GGRNA Home | Help | Advanced search

2019-03-25 08:34:51, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_000045               1475 bp    mRNA    linear   PRI 26-MAY-2013
DEFINITION  Homo sapiens arginase, liver (ARG1), transcript variant 2, mRNA.
ACCESSION   NM_000045
VERSION     NM_000045.3  GI:346986433
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1475)
  AUTHORS   Vasquez-Dunddel,D., Pan,F., Zeng,Q., Gorbounov,M., Albesiano,E.,
            Fu,J., Blosser,R.L., Tam,A.J., Bruno,T., Zhang,H., Pardoll,D. and
            Kim,Y.
  TITLE     STAT3 regulates arginase-I in myeloid-derived suppressor cells from
            cancer patients
  JOURNAL   J. Clin. Invest. 123 (4), 1580-1589 (2013)
   PUBMED   23454751
  REMARK    GeneRIF: The tumor suppressive function of arginase-I in both
            infiltrating and circulating myeloid-derived suppressor cells is a
            downstream target of activated STAT3.
REFERENCE   2  (bases 1 to 1475)
  AUTHORS   Mao,H., Gao,W., Lu,G., Fang,F. and Teng,L.
  TITLE     Clinicopathological and prognostic implications of arginase
            expression in hepatocellular carcinoma
  JOURNAL   Clin. Lab. 59 (1-2), 37-43 (2013)
   PUBMED   23505904
  REMARK    GeneRIF: results suggest that Arg-1 may play a tumor suppressive
            role in HCC and could be a new, promising prognostic biomarker for
            HCC patients
REFERENCE   3  (bases 1 to 1475)
  AUTHORS   Carvalho,D.R., Brand,G.D., Brum,J.M., Takata,R.I.,
            Speck-Martins,C.E. and Pratesi,R.
  TITLE     Analysis of novel ARG1 mutations causing hyperargininemia and
            correlation with arginase I activity in erythrocytes
  JOURNAL   Gene 509 (1), 124-130 (2012)
   PUBMED   22959135
  REMARK    GeneRIF: Three previously reported mutations were found (p.R21X;
            p.I11T and p.W122X), and five novel mutations were identified
            (p.G27D; p.G74V; p.T134I; p.R308Q; p.I174fs179).
REFERENCE   4  (bases 1 to 1475)
  AUTHORS   D'Antonio,E.L., Hai,Y. and Christianson,D.W.
  TITLE     Structure and function of non-native metal clusters in human
            arginase I
  JOURNAL   Biochemistry 51 (42), 8399-8409 (2012)
   PUBMED   23061982
  REMARK    GeneRIF: we establish the following trend for turnover number
            (k(cat)) and catalytic efficiency (k(cat)/K(M)): Mn(2+) > Ni(2+)
            approximately Co(2+) >> Zn(2+). Therefore, Mn(2+) is required for
            optimal catalysis by human arginase I.
REFERENCE   5  (bases 1 to 1475)
  AUTHORS   Radwan,N.A. and Ahmed,N.S.
  TITLE     The diagnostic value of arginase-1 immunostaining in
            differentiating hepatocellular carcinoma from metastatic carcinoma
            and cholangiocarcinoma as compared to HepPar-1
  JOURNAL   Diagn Pathol 7, 149 (2012)
   PUBMED   23111165
  REMARK    GeneRIF: Combined use of arginase-1 and HepPar-1 can provide a
            potentially promising tool to improve the accuracy in
            distinguishing hepatocellular carcinoma from metastatic carcinoma
            and cholangiocarcinoma.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1475)
  AUTHORS   Uchino,T., Haraguchi,Y., Aparicio,J.M., Mizutani,N.,
            Higashikawa,M., Naitoh,H., Mori,M. and Matsuda,I.
  TITLE     Three novel mutations in the liver-type arginase gene in three
            unrelated Japanese patients with argininemia
  JOURNAL   Am. J. Hum. Genet. 51 (6), 1406-1412 (1992)
   PUBMED   1463019
REFERENCE   7  (bases 1 to 1475)
  AUTHORS   Grody,W.W., Klein,D., Dodson,A.E., Kern,R.M., Wissmann,P.B.,
            Goodman,B.K., Bassand,P., Marescau,B., Kang,S.S., Leonard,J.V. et
            al.
  TITLE     Molecular genetic study of human arginase deficiency
  JOURNAL   Am. J. Hum. Genet. 50 (6), 1281-1290 (1992)
   PUBMED   1598908
REFERENCE   8  (bases 1 to 1475)
  AUTHORS   Ikemoto,M., Tabata,M., Miyake,T., Kono,T., Mori,M., Totani,M. and
            Murachi,T.
  TITLE     Expression of human liver arginase in Escherichia coli.
            Purification and properties of the product
  JOURNAL   Biochem. J. 270 (3), 697-703 (1990)
   PUBMED   2241902
REFERENCE   9  (bases 1 to 1475)
  AUTHORS   Haraguchi,Y., Aparicio,J.M., Takiguchi,M., Akaboshi,I., Yoshino,M.,
            Mori,M. and Matsuda,I.
  TITLE     Molecular basis of argininemia. Identification of two discrete
            frame-shift deletions in the liver-type arginase gene
  JOURNAL   J. Clin. Invest. 86 (1), 347-350 (1990)
   PUBMED   2365823
REFERENCE   10 (bases 1 to 1475)
  AUTHORS   Grody,W.W., Argyle,C., Kern,R.M., Dizikes,G.J., Spector,E.B.,
            Strickland,A.D., Klein,D. and Cederbaum,S.D.
  TITLE     Differential expression of the two human arginase genes in
            hyperargininemia. Enzymatic, pathologic, and molecular analysis
  JOURNAL   J. Clin. Invest. 83 (2), 602-609 (1989)
   PUBMED   2913054
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BG217880.1, BG542163.1,
            BC020653.1 and AW236349.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Sep 16, 2011 this sequence version replaced gi:10947138.
            
            Summary: Arginase catalyzes the hydrolysis of arginine to ornithine
            and urea. At least two isoforms of mammalian arginase exist (types
            I and II) which differ in their tissue distribution, subcellular
            localization, immunologic crossreactivity and physiologic function.
            The type I isoform encoded by this gene, is a cytosolic enzyme and
            expressed predominantly in the liver as a component of the urea
            cycle. Inherited deficiency of this enzyme results in argininemia,
            an autosomal recessive disorder characterized by hyperammonemia.
            Two transcript variants encoding different isoforms have been found
            for this gene. [provided by RefSeq, Sep 2011].
            
            Transcript Variant: This variant (2) uses an alternate in-frame
            splice site at the 5' end of an exon compared to variant 1. The
            resulting isoform (2) has the same N- and C-termini but is shorter
            compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: M14502.1, BC020653.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-14                BG217880.1         62-75
            15-74               BG542163.1         17-76
            75-1469             BC020653.1         1-1395
            1470-1475           AW236349.1         1-6                 c
FEATURES             Location/Qualifiers
     source          1..1475
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6q23"
     gene            1..1475
                     /gene="ARG1"
                     /note="arginase, liver"
                     /db_xref="GeneID:383"
                     /db_xref="HGNC:663"
                     /db_xref="HPRD:01947"
                     /db_xref="MIM:608313"
     exon            1..136
                     /gene="ARG1"
                     /inference="alignment:Splign:1.39.8"
     variation       10
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192353153"
     variation       15
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17788484"
     misc_feature    35..37
                     /gene="ARG1"
                     /note="upstream in-frame stop codon"
     variation       59
                     /gene="ARG1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370747314"
     CDS             80..1048
                     /gene="ARG1"
                     /EC_number="3.5.3.1"
                     /note="isoform 2 is encoded by transcript variant 2; type
                     I arginase; liver-type arginase"
                     /codon_start=1
                     /product="arginase-1 isoform 2"
                     /protein_id="NP_000036.2"
                     /db_xref="GI:10947139"
                     /db_xref="CCDS:CCDS5145.1"
                     /db_xref="GeneID:383"
                     /db_xref="HGNC:663"
                     /db_xref="HPRD:01947"
                     /db_xref="MIM:608313"
                     /translation="
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
"
     misc_feature    104..988
                     /gene="ARG1"
                     /note="Arginase types I and II and arginase-like family;
                     Region: Arginase-like; cd11587"
                     /db_xref="CDD:212536"
     misc_feature    order(119..121,128..130,152..157,164..166,173..175,
                     224..226,233..238,803..805,815..817,827..829,839..844,
                     950..952,959..964,971..973,983..985)
                     /gene="ARG1"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212536"
     misc_feature    order(380..382,449..451,455..457,461..463,500..502,
                     773..775,779..781,908..910)
                     /gene="ARG1"
                     /note="active site"
                     /db_xref="CDD:212536"
     misc_feature    order(380..382,449..451,455..457,461..463,773..775,
                     779..781)
                     /gene="ARG1"
                     /note="Mn binding site [ion binding]; other site"
                     /db_xref="CDD:212536"
     misc_feature    455..469
                     /gene="ARG1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P05089.2);
                     Region: Substrate binding"
     misc_feature    488..496
                     /gene="ARG1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P05089.2);
                     Region: Substrate binding"
     variation       85
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138584410"
     variation       102
                     /gene="ARG1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:149310631"
     variation       111
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:28941474"
     variation       114
                     /gene="ARG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147419581"
     variation       136
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150766204"
     exon            137..209
                     /gene="ARG1"
                     /inference="alignment:Splign:1.39.8"
     variation       140
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:104893944"
     variation       141
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144994895"
     variation       156
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11544411"
     exon            210..384
                     /gene="ARG1"
                     /inference="alignment:Splign:1.39.8"
     variation       214
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372415368"
     variation       223
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375655714"
     variation       236
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188888028"
     variation       249
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147146526"
     variation       264
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111640755"
     variation       310
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369393679"
     variation       316
                     /gene="ARG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148619575"
     variation       320
                     /gene="ARG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142107090"
     variation       335
                     /gene="ARG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1063493"
     variation       349
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34504481"
     variation       350
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374676787"
     variation       360
                     /gene="ARG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:34724840"
     exon            385..544
                     /gene="ARG1"
                     /inference="alignment:Splign:1.39.8"
     variation       412
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200458963"
     variation       444
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:104893947"
     variation       462
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140549609"
     variation       492
                     /gene="ARG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:104893943"
     exon            545..639
                     /gene="ARG1"
                     /inference="alignment:Splign:1.39.8"
     variation       546
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200319835"
     variation       553
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144403253"
     variation       561
                     /gene="ARG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201484132"
     variation       571
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146625637"
     variation       601
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370289649"
     variation       616
                     /gene="ARG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201926198"
     exon            640..744
                     /gene="ARG1"
                     /inference="alignment:Splign:1.39.8"
     variation       643
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376378819"
     variation       673
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149496218"
     variation       719
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200496725"
     variation       744
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145177175"
     exon            745..881
                     /gene="ARG1"
                     /inference="alignment:Splign:1.39.8"
     variation       760
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138705915"
     variation       781
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148939143"
     variation       782
                     /gene="ARG1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:104893948"
     variation       824
                     /gene="ARG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182650447"
     variation       848
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372489226"
     variation       877
                     /gene="ARG1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:111253965"
     exon            882..1472
                     /gene="ARG1"
                     /inference="alignment:Splign:1.39.8"
     variation       935
                     /gene="ARG1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370022660"
     variation       948
                     /gene="ARG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:104893942"
     variation       950
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:104893940"
     variation       986
                     /gene="ARG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148113697"
     variation       991
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373480378"
     variation       1002
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377280518"
     variation       1003
                     /gene="ARG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370831108"
     variation       1004
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373491227"
     variation       1023
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202219126"
     variation       1032
                     /gene="ARG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73544627"
     variation       1035
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147409787"
     variation       1170
                     /gene="ARG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1803151"
     STS             1258..1427
                     /gene="ARG1"
                     /standard_name="STS-M14502"
                     /db_xref="UniSTS:40466"
     variation       1358
                     /gene="ARG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142812031"
     polyA_signal    1449..1454
                     /gene="ARG1"
     polyA_site      1472
                     /gene="ARG1"
ORIGIN      
ggaaaaaaaagatgcgccctctgtcactgagggttgactgactggagagctcaagtgcagcaaagagaagtgtcagagcatgagcgccaagtccagaaccatagggattattggagctcctttctcaaagggacagccacgaggaggggtggaagaaggccctacagtattgagaaaggctggtctgcttgagaaacttaaagaacaagagtgtgatgtgaaggattatggggacctgccctttgctgacatccctaatgacagtccctttcaaattgtgaagaatccaaggtctgtgggaaaagcaagcgagcagctggctggcaaggtggcagaagtcaagaagaacggaagaatcagcctggtgctgggcggagaccacagtttggcaattggaagcatctctggccatgccagggtccaccctgatcttggagtcatctgggtggatgctcacactgatatcaacactccactgacaaccacaagtggaaacttgcatggacaacctgtatctttcctcctgaaggaactaaaaggaaagattcccgatgtgccaggattctcctgggtgactccctgtatatctgccaaggatattgtgtatattggcttgagagacgtggaccctggggaacactacattttgaaaactctaggcattaaatacttttcaatgactgaagtggacagactaggaattggcaaggtgatggaagaaacactcagctatctactaggaagaaagaaaaggccaattcatctaagttttgatgttgacggactggacccatctttcacaccagctactggcacaccagtcgtgggaggtctgacatacagagaaggtctctacatcacagaagaaatctacaaaacagggctactctcaggattagatataatggaagtgaacccatccctggggaagacaccagaagaagtaactcgaacagtgaacacagcagttgcaataaccttggcttgtttcggacttgctcgggagggtaatcacaagcctattgactaccttaacccacctaagtaaatgtggaaacatccgatataaatctcatagttaatggcataattagaaagctaatcattttcttaagcatagagttatccttctaaagacttgttctttcagaaaaatgtttttccaattagtataaactctacaaattccctcttggtgtaaaattcaagatgtggaaattctaacttttttgaaatttaaaagcttatattttctaacttggcaaaagacttatccttagaaagagaagtgtacattgatttccaattaaaaatttgctggcattaaaaataagcacacttacataagcccccatacatagagtgggactcttggaatcaggagacaaagctaccacatgtggaaaggtactatgtgtccatgtcattcaaaaaatgtgattttttataataaactctttataacaagattaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:383 -> Molecular function: GO:0004053 [arginase activity] evidence: EXP
            GeneID:383 -> Molecular function: GO:0030145 [manganese ion binding] evidence: IEA
            GeneID:383 -> Biological process: GO:0000050 [urea cycle] evidence: IEA
            GeneID:383 -> Biological process: GO:0000050 [urea cycle] evidence: TAS
            GeneID:383 -> Biological process: GO:0001889 [liver development] evidence: IEA
            GeneID:383 -> Biological process: GO:0001938 [positive regulation of endothelial cell proliferation] evidence: IEA
            GeneID:383 -> Biological process: GO:0006527 [arginine catabolic process] evidence: TAS
            GeneID:383 -> Biological process: GO:0009635 [response to herbicide] evidence: IEA
            GeneID:383 -> Biological process: GO:0010042 [response to manganese ion] evidence: IEA
            GeneID:383 -> Biological process: GO:0010043 [response to zinc ion] evidence: IEA
            GeneID:383 -> Biological process: GO:0010269 [response to selenium ion] evidence: IEA
            GeneID:383 -> Biological process: GO:0010963 [regulation of L-arginine import] evidence: IEA
            GeneID:383 -> Biological process: GO:0014075 [response to amine stimulus] evidence: IEA
            GeneID:383 -> Biological process: GO:0030324 [lung development] evidence: IEA
            GeneID:383 -> Biological process: GO:0032964 [collagen biosynthetic process] evidence: IEA
            GeneID:383 -> Biological process: GO:0033189 [response to vitamin A] evidence: IEA
            GeneID:383 -> Biological process: GO:0033197 [response to vitamin E] evidence: IEA
            GeneID:383 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
            GeneID:383 -> Biological process: GO:0042493 [response to drug] evidence: IEA
            GeneID:383 -> Biological process: GO:0043200 [response to amino acid stimulus] evidence: IEA
            GeneID:383 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
            GeneID:383 -> Biological process: GO:0046686 [response to cadmium ion] evidence: IEA
            GeneID:383 -> Biological process: GO:0048678 [response to axon injury] evidence: IEA
            GeneID:383 -> Biological process: GO:0051597 [response to methylmercury] evidence: IEA
            GeneID:383 -> Biological process: GO:0060056 [mammary gland involution] evidence: IEA
            GeneID:383 -> Biological process: GO:0060135 [maternal process involved in female pregnancy] evidence: IEA
            GeneID:383 -> Biological process: GO:0070207 [protein homotrimerization] evidence: IEA
            GeneID:383 -> Biological process: GO:0070301 [cellular response to hydrogen peroxide] evidence: IEA
            GeneID:383 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IEA
            GeneID:383 -> Biological process: GO:0071377 [cellular response to glucagon stimulus] evidence: IEA
            GeneID:383 -> Biological process: GO:0071549 [cellular response to dexamethasone stimulus] evidence: IEA
            GeneID:383 -> Biological process: GO:0071560 [cellular response to transforming growth factor beta stimulus] evidence: IEA
            GeneID:383 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
            GeneID:383 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
            GeneID:383 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
            GeneID:383 -> Cellular component: GO:0043005 [neuron projection] evidence: IEA
            GeneID:383 -> Cellular component: GO:0043025 [neuronal cell body] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_000036 -> EC 3.5.3.1

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.