2025-10-20 11:14:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_172102 981 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens CD8b molecule (CD8B), transcript variant 4, mRNA. ACCESSION NM_172102 VERSION NM_172102.3 GI:296010930 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 981) AUTHORS Heigele,A., Schindler,M., Gnanadurai,C.W., Leonard,J.A., Collins,K.L. and Kirchhoff,F. TITLE Down-modulation of CD8alphabeta is a fundamental activity of primate lentiviral Nef proteins JOURNAL J. Virol. 86 (1), 36-48 (2012) PUBMED 22013062 REMARK GeneRIF: Nef-mediated down-modulation of CD8alphabeta is a fundamental property of primate lentiviruses. REFERENCE 2 (bases 1 to 981) AUTHORS Laugel,B., Cole,D.K., Clement,M., Wooldridge,L., Price,D.A. and Sewell,A.K. TITLE The multiple roles of the CD8 coreceptor in T cell biology: opportunities for the selective modulation of self-reactive cytotoxic T cells JOURNAL J. Leukoc. Biol. 90 (6), 1089-1099 (2011) PUBMED 21954283 REMARK GeneRIF: [review] Coreceptor CD8alphabeta contributes to the antigen-recognition process by binding to a largely invariant region of the MHCI molecule and by promoting intracellular signaling. Review article REFERENCE 3 (bases 1 to 981) AUTHORS Hoglinger,G.U., Melhem,N.M., Dickson,D.W., Sleiman,P.M., Wang,L.S., Klei,L., Rademakers,R., de Silva,R., Litvan,I., Riley,D.E., van Swieten,J.C., Heutink,P., Wszolek,Z.K., Uitti,R.J., Vandrovcova,J., Hurtig,H.I., Gross,R.G., Maetzler,W., Goldwurm,S., Tolosa,E., Borroni,B., Pastor,P., Cantwell,L.B., Han,M.R., Dillman,A., van der Brug,M.P., Gibbs,J.R., Cookson,M.R., Hernandez,D.G., Singleton,A.B., Farrer,M.J., Yu,C.E., Golbe,L.I., Revesz,T., Hardy,J., Lees,A.J., Devlin,B., Hakonarson,H., Muller,U. and Schellenberg,G.D. CONSRTM PSP Genetics Study Group TITLE Identification of common variants influencing risk of the tauopathy progressive supranuclear palsy JOURNAL Nat. Genet. 43 (7), 699-705 (2011) PUBMED 21685912 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 981) AUTHORS Chen,M.L., Yan,B.S., Kozoriz,D. and Weiner,H.L. TITLE Novel CD8+ Treg suppress EAE by TGF-beta- and IFN-gamma-dependent mechanisms JOURNAL Eur. J. Immunol. 39 (12), 3423-3435 (2009) PUBMED 19768696 REMARK GeneRIF: Data show that CD8+LAP+ cells produce IFN-gamma, and these cells suppress EAE that is dependent on both TGF-beta and IFN-gamma. REFERENCE 5 (bases 1 to 981) AUTHORS Thakral,D., Dobbins,J., Devine,L. and Kavathas,P.B. TITLE Differential expression of the human CD8beta splice variants and regulation of the M-2 isoform by ubiquitination JOURNAL J. Immunol. 180 (11), 7431-7442 (2008) PUBMED 18490743 REMARK GeneRIF: study demonstrated differential mRNA expression patterns of CD8beta splice variants in thymocytes and in resting, memory, and activated primary CD8(+) T cells REFERENCE 6 (bases 1 to 981) AUTHORS Nakayama,K., Kawachi,Y., Tokito,S., Minami,N., Yamamoto,R., Imai,T., Gachelin,G. and Nakauchi,H. TITLE Recent duplication of the two human CD8 beta-chain genes JOURNAL J. Immunol. 148 (6), 1919-1927 (1992) PUBMED 1541829 REFERENCE 7 (bases 1 to 981) AUTHORS Terry,L.A., DiSanto,J.P., Small,T.N. and Flomenberg,N. TITLE Differential expression and regulation of the human CD8 alpha and CD8 beta chains JOURNAL Tissue Antigens 35 (2), 82-91 (1990) PUBMED 2111591 REFERENCE 8 (bases 1 to 981) AUTHORS Parnes,J.R. TITLE Molecular biology and function of CD4 and CD8 JOURNAL Adv. Immunol. 44, 265-311 (1989) PUBMED 2493728 REMARK Review article REFERENCE 9 (bases 1 to 981) AUTHORS Norment,A.M. and Littman,D.R. TITLE A second subunit of CD8 is expressed in human T cells JOURNAL EMBO J. 7 (11), 3433-3439 (1988) PUBMED 3145195 REFERENCE 10 (bases 1 to 981) AUTHORS Johnson,P. TITLE A human homolog of the mouse CD8 molecule, Lyt-3: genomic sequence and expression JOURNAL Immunogenetics 26 (3), 174-177 (1987) PUBMED 3114136 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DC405359.1, BC100912.2, X13446.1 and AW296309.1. On May 13, 2010 this sequence version replaced gi:90421318. Summary: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. [provided by RefSeq, May 2010]. Transcript Variant: This variant (4), also known as S-1, lacks an in-frame exon in the coding region, compared to variant 2. The resulting secreted protein (isoform 4) is shorter than isoform 2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: X13446.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025084, ERS025088 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-83 DC405359.1 1-83 84-84 BC100912.2 75-75 85-768 X13446.1 76-759 769-981 AW296309.1 4-216 c FEATURES Location/Qualifiers source 1..981 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" /map="2p12" gene 1..981 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /note="CD8b molecule" /db_xref="GeneID:926" /db_xref="HGNC:1707" /db_xref="HPRD:01725" /db_xref="MIM:186730" exon 1..102 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /inference="alignment:Splign:1.39.8" STS 10..751 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /db_xref="UniSTS:482959" CDS 60..701 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /note="isoform 4 precursor is encoded by transcript variant 4; CD8 antigen, beta polypeptide 1 (p37); T lymphocyte surface glycoprotein beta chain" /codon_start=1 /product="T-cell surface glycoprotein CD8 beta chain isoform 4 precursor" /protein_id="NP_742100.1" /db_xref="GI:27886637" /db_xref="CCDS:CCDS1994.1" /db_xref="GeneID:926" /db_xref="HGNC:1707" /db_xref="HPRD:01725" /db_xref="MIM:186730" /translation="
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT
" sig_peptide 60..122 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" misc_feature 117..461 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /note="Immunoglobulin V-set domain; Region: V-set; pfam07686" /db_xref="CDD:203725" mat_peptide 123..698 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /product="T-cell surface glycoprotein CD8 beta chain isoform 4" misc_feature 144..461 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /note="Immunoglobulin (Ig) like domain of CD8 beta chain; Region: IgV_CD8_beta; cd07700" /db_xref="CDD:143324" misc_feature order(216..218,228..230,258..260,264..266,414..416, 435..440) /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /note="heterodimer interface [polypeptide binding]; other site" /db_xref="CDD:143324" misc_feature 477..479 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /experiment="experimental evidence, no additional details recorded" /note="glycosylation site" /db_xref="HPRD:00084" misc_feature 480..482 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /experiment="experimental evidence, no additional details recorded" /note="glycosylation site" /db_xref="HPRD:00084" misc_feature 492..494 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /experiment="experimental evidence, no additional details recorded" /note="glycosylation site" /db_xref="HPRD:00084" misc_feature 504..506 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /experiment="experimental evidence, no additional details recorded" /note="glycosylation site" /db_xref="HPRD:00084" exon 103..462 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /inference="alignment:Splign:1.39.8" variation 210 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /replace="c" /replace="t" /db_xref="dbSNP:11558603" exon 463..552 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /inference="alignment:Splign:1.39.8" exon 553..589 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /inference="alignment:Splign:1.39.8" exon 590..971 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /inference="alignment:Splign:1.39.8" STS 603..730 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" /standard_name="SHGC-11929" /db_xref="UniSTS:54999" polyA_signal 916..921 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" polyA_site 939 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" polyA_site 971 /gene="CD8B" /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37" ORIGIN
accccagccgcgactgtctccgccgagcccccggggccaggtgtcccgggcgcgccacgatgcggccgcggctgtggctcctcttggccgcgcagctgacagttctccatggcaactcagtcctccagcagacccctgcatacataaaggtgcaaaccaacaagatggtgatgctgtcctgcgaggctaaaatctccctcagtaacatgcgcatctactggctgagacagcgccaggcaccgagcagtgacagtcaccacgagttcctggccctctgggattccgcaaaagggactatccacggtgaagaggtggaacaggagaagatagctgtgtttcgggatgcaagccggttcattctcaatctcacaagcgtgaagccggaagacagtggcatctacttctgcatgatcgtcgggagccccgagctgaccttcgggaagggaactcagctgagtgtggttgatttccttcccaccactgcccagcccaccaagaagtccaccctcaagaagagagtgtgccggttacccaggccagagacccagaagggccggcggaggagagcccggcttcgtttcatgaaacagcctcaaggggaaggtatatcaggaacctttgtcccccaatgcctgcatggatactacagcaatactacaacctcacagaagctgcttaacccatggatcctgaaaacataggcaagaagcacaggtcctgatgagtggatctttactacttttaccagattcctccctcgctcagagggatcctcccacacacccagcagagacttctctgccaccatcaaccccccaagtcatagggggctcaagttctgccctggtgagctgtggcccccatccttgtgaaccccaaagtgtcccccttgtggaaccaaatgtatccatcttgaataaatttgcccaaaatcctaaagaccgggaaaagggaaccattgagcttggcaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:926 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:926 -> Molecular function: GO:0015026 [coreceptor activity] evidence: NAS GeneID:926 -> Molecular function: GO:0042288 [MHC class I protein binding] evidence: NAS GeneID:926 -> Biological process: GO:0006955 [immune response] evidence: NAS GeneID:926 -> Biological process: GO:0007169 [transmembrane receptor protein tyrosine kinase signaling pathway] evidence: NAS GeneID:926 -> Biological process: GO:0016032 [viral process] evidence: TAS GeneID:926 -> Biological process: GO:0042110 [T cell activation] evidence: NAS GeneID:926 -> Biological process: GO:0050690 [regulation of defense response to virus by virus] evidence: TAS GeneID:926 -> Biological process: GO:0050776 [regulation of immune response] evidence: TAS GeneID:926 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA GeneID:926 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS GeneID:926 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS GeneID:926 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IEA GeneID:926 -> Cellular component: GO:0031901 [early endosome membrane] evidence: TAS GeneID:926 -> Cellular component: GO:0042101 [T cell receptor complex] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.