Home |
Help |
Advanced search
2025-05-09 16:28:54, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_007074 1825 bp mRNA linear PRI 15-JUN-2013
DEFINITION Homo sapiens coronin, actin binding protein, 1A (CORO1A),
transcript variant 2, mRNA.
ACCESSION NM_007074
VERSION NM_007074.3 GI:306482593
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1825)
AUTHORS Oku,T., Nakano,M., Kaneko,Y., Ando,Y., Kenmotsu,H., Itoh,S.,
Tsuiji,M., Seyama,Y., Toyoshima,S. and Tsuji,T.
TITLE Constitutive turnover of phosphorylation at Thr-412 of human
p57/coronin-1 regulates the interaction with actin
JOURNAL J. Biol. Chem. 287 (51), 42910-42920 (2012)
PUBMED 23100250
REMARK GeneRIF: Constitutive turnover of phosphorylation at Thr-412 of
p57/coronin-1 regulates its interaction with actin.
REFERENCE 2 (bases 1 to 1825)
AUTHORS Castro-Castro,A., Ojeda,V., Barreira,M., Sauzeau,V.,
Navarro-Lerida,I., Muriel,O., Couceiro,J.R., Pimentel-Muinos,F.X.,
Del Pozo,M.A. and Bustelo,X.R.
TITLE Coronin 1A promotes a cytoskeletal-based feedback loop that
facilitates Rac1 translocation and activation
JOURNAL EMBO J. 30 (19), 3913-3927 (2011)
PUBMED 21873980
REMARK GeneRIF: Coronin 1A promotes a cytoskeletal-based feedback loop
that facilitates Rac1 translocation and activation
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 1825)
AUTHORS Mueller,P., Liu,X. and Pieters,J.
TITLE Migration and homeostasis of naive T cells depends on coronin
1-mediated prosurvival signals and not on coronin 1-dependent
filamentous actin modulation
JOURNAL J. Immunol. 186 (7), 4039-4050 (2011)
PUBMED 21339362
REMARK GeneRIF: Instead of regulating the F-actin cytoskeleton, coronin 1
functions in balancing pro- and antiapoptotic signals by regulating
divalent calcium ion fluxes and calcineurin activation downstream
of the T cell receptor.
REFERENCE 4 (bases 1 to 1825)
AUTHORS Moriceau,S., Kantari,C., Mocek,J., Davezac,N., Gabillet,J.,
Guerrera,I.C., Brouillard,F., Tondelier,D., Sermet-Gaudelus,I.,
Danel,C., Lenoir,G., Daniel,S., Edelman,A. and Witko-Sarsat,V.
TITLE Coronin-1 is associated with neutrophil survival and is cleaved
during apoptosis: potential implication in neutrophils from cystic
fibrosis patients
JOURNAL J. Immunol. 182 (11), 7254-7263 (2009)
PUBMED 19454722
REMARK GeneRIF: Circulating neutrophils from CF patients had more
coronin-1 expression, associated with a lower apoptosis rate
REFERENCE 5 (bases 1 to 1825)
AUTHORS Shiow,L.R., Roadcap,D.W., Paris,K., Watson,S.R., Grigorova,I.L.,
Lebet,T., An,J., Xu,Y., Jenne,C.N., Foger,N., Sorensen,R.U.,
Goodnow,C.C., Bear,J.E., Puck,J.M. and Cyster,J.G.
TITLE The actin regulator coronin 1A is mutant in a thymic
egress-deficient mouse strain and in a patient with severe combined
immunodeficiency
JOURNAL Nat. Immunol. 9 (11), 1307-1315 (2008)
PUBMED 18836449
REMARK GeneRIF: Findings establish a function for coronin 1A in T cell
egress, identify a surface of coronin involved in Arp2/3
regulation.
REFERENCE 6 (bases 1 to 1825)
AUTHORS Vanguri,V.K., Wang,S., Godyna,S., Ranganathan,S. and Liau,G.
TITLE Thrombospondin-1 binds to polyhistidine with high affinity and
specificity
JOURNAL Biochem. J. 347 (PT 2), 469-473 (2000)
PUBMED 10749676
REFERENCE 7 (bases 1 to 1825)
AUTHORS Ferrari,G., Langen,H., Naito,M. and Pieters,J.
TITLE A coat protein on phagosomes involved in the intracellular survival
of mycobacteria
JOURNAL Cell 97 (4), 435-447 (1999)
PUBMED 10338208
REFERENCE 8 (bases 1 to 1825)
AUTHORS Okumura,M., Kung,C., Wong,S., Rodgers,M. and Thomas,M.L.
TITLE Definition of family of coronin-related proteins conserved between
humans and mice: close genetic linkage between coronin-2 and
CD45-associated protein
JOURNAL DNA Cell Biol. 17 (9), 779-787 (1998)
PUBMED 9778037
REFERENCE 9 (bases 1 to 1825)
AUTHORS Grogan,A., Reeves,E., Keep,N., Wientjes,F., Totty,N.F.,
Burlingame,A.L., Hsuan,J.J. and Segal,A.W.
TITLE Cytosolic phox proteins interact with and regulate the assembly of
coronin in neutrophils
JOURNAL J. Cell. Sci. 110 (PT 24), 3071-3081 (1997)
PUBMED 9365277
REFERENCE 10 (bases 1 to 1825)
AUTHORS Suzuki,K., Nishihata,J., Arai,Y., Honma,N., Yamamoto,K., Irimura,T.
and Toyoshima,S.
TITLE Molecular cloning of a novel actin-binding protein, p57, with a WD
repeat and a leucine zipper motif
JOURNAL FEBS Lett. 364 (3), 283-288 (1995)
PUBMED 7758584
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DC408372.1, DA256300.1,
BC110374.1 and U34690.1.
On Sep 9, 2010 this sequence version replaced gi:68161542.
Summary: This gene encodes a member of the WD repeat protein
family. WD repeats are minimally conserved regions of approximately
40 amino acids typically bracketed by gly-his and trp-asp (GH-WD),
which may facilitate formation of heterotrimeric or multiprotein
complexes. Members of this family are involved in a variety of
cellular processes, including cell cycle progression, signal
transduction, apoptosis, and gene regulation. Alternative splicing
results in multiple transcript variants. A related pseudogene has
been defined on chromosome 16. [provided by RefSeq, Sep 2010].
Transcript Variant: This variant (2) differs in the 5' UTR compared
to variant 1. Both variants 1 and 2 encode the same protein.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC110374.1, U34690.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-109 DC408372.1 1-109
110-183 DA256300.1 98-171
184-652 BC110374.1 1-469
653-653 U34690.1 428-428
654-1825 BC110374.1 471-1642
FEATURES Location/Qualifiers
source 1..1825
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="16"
/map="16p11.2"
gene 1..1825
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="coronin, actin binding protein, 1A"
/db_xref="GeneID:11151"
/db_xref="HGNC:2252"
/db_xref="HPRD:05414"
/db_xref="MIM:605000"
exon 1..316
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 110
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:930392"
misc_feature 204..206
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="upstream in-frame stop codon"
variation 224
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="g"
/replace="t"
/db_xref="dbSNP:186185074"
STS 249..1780
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/db_xref="UniSTS:486443"
variation 284
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:11555340"
STS 297..1742
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/db_xref="UniSTS:494834"
exon 317..515
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
CDS 318..1703
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="coronin-1; clipin-A; coronin-like protein A;
coronin-like protein p57; tryptophan aspartate-containing
coat protein"
/codon_start=1
/product="coronin-1A"
/protein_id="NP_009005.1"
/db_xref="GI:5902134"
/db_xref="CCDS:CCDS10673.1"
/db_xref="GeneID:11151"
/db_xref="HGNC:2252"
/db_xref="HPRD:05414"
/db_xref="MIM:605000"
/translation="
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
"
misc_feature 321..323
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylserine; propagated from
UniProtKB/Swiss-Prot (P31146.4); acetylation site"
misc_feature 321..323
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by PKC; propagated from
UniProtKB/Swiss-Prot (P31146.4); phosphorylation site"
misc_feature 327..521
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="Domain of unknown function (DUF1899); Region:
DUF1899; pfam08953"
/db_xref="CDD:149883"
misc_feature 342..1700
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="coronin; Provisional; Region: PTZ00421"
/db_xref="CDD:173611"
misc_feature 354..506
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 1"
misc_feature 534..647
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 2"
misc_feature 543..1223
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="WD40 domain, found in a number of eukaryotic
proteins that cover a wide variety of functions including
adaptor/regulatory modules in signal transduction,
pre-mRNA processing and cytoskeleton assembly; typically
contains a GH dipeptide 11-24 residues from...; Region:
WD40; cl02567"
/db_xref="CDD:207648"
misc_feature order(552..557,612..614,624..626,642..647,702..707,
759..761,774..776,792..797,840..842,891..893,906..908,
924..929,975..977,1023..1025,1047..1049,1065..1070,
1104..1106,1113..1115,1167..1169,1182..1184,1200..1205)
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="structural tetrad; other site"
/db_xref="CDD:29257"
misc_feature 684..797
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 3"
misc_feature 807..929
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 4"
misc_feature 936..1070
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 5"
misc_feature 1089..1493
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="Domain of unknown function (DUF1900); Region:
DUF1900; pfam08954"
/db_xref="CDD:149884"
misc_feature 1089..1205
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 6"
misc_feature 1221..1364
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 7"
misc_feature 1551..1553
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by PKC; propagated from
UniProtKB/Swiss-Prot (P31146.4); phosphorylation site"
misc_feature 1662..1664
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P31146.4); acetylation site"
variation 371
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="g"
/db_xref="dbSNP:61736363"
variation 399
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:201747422"
variation 436
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="g"
/replace="t"
/db_xref="dbSNP:79062603"
variation 485
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:75142051"
exon 516..638
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 538
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:373022238"
variation 554
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:201766395"
variation 555
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="g"
/db_xref="dbSNP:11555342"
variation 590
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:141844867"
variation 602
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:184262856"
variation 636
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:201579444"
exon 639..768
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 653
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:1132812"
variation 663
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:138146826"
variation 678
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:370896577"
variation 684
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:201721540"
variation 686
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:200437355"
variation 689
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:149599538"
variation 690
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:143294920"
variation 707
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:201119953"
exon 769..953
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 811
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:371653086"
variation 812
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:374849081"
variation 836
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:199752871"
variation 857
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:369595327"
variation 874
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:148312916"
variation 878
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:141746241"
variation 921
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:145989561"
variation 947
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:139989282"
variation 948
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:371818902"
exon 954..1073
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 963
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:377504027"
variation 966
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:141827038"
variation 1001
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:371077364"
variation 1028
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:374088140"
variation 1055
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:143729497"
variation 1061
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:200060318"
exon 1074..1178
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1091
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:187747730"
variation 1093
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="t"
/db_xref="dbSNP:200963965"
variation 1109
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:139024575"
variation 1121
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:149867063"
variation 1154
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:113875403"
variation 1160
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:199650298"
exon 1179..1324
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1253
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:148629867"
variation 1262
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="g"
/db_xref="dbSNP:144860668"
variation 1271
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:376912665"
variation 1313
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:199960741"
STS 1316..1453
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/standard_name="RH47208"
/db_xref="UniSTS:88686"
variation 1319
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:377351892"
exon 1325..1382
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1344
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:112289496"
variation 1349
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:199896375"
exon 1383..1598
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1391
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="g"
/db_xref="dbSNP:376540649"
variation 1394
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:147924993"
variation 1414
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:150857828"
variation 1418
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:139282852"
variation 1463
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:201734831"
variation 1465
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:61736366"
variation 1478
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:375181897"
variation 1489
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:375532115"
variation 1505
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:151106018"
variation 1506
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:35967690"
variation 1521
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:150186033"
variation 1527
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:11555339"
variation 1531
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="g"
/replace="t"
/db_xref="dbSNP:369828613"
variation 1539
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:373093101"
variation 1550
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:138821284"
variation 1556
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:199576607"
variation 1561
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:1804109"
exon 1599..1815
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1644
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:1053574"
variation 1661
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:3209337"
polyA_signal 1791..1796
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
polyA_site 1815
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
ORIGIN
aaaaagaagtttagattcgcttcccggagccgggatggcagcctgcgctatggttggggaccaacgtggtgcacgggcaggggccggggagagaggcggccgcagcgggagcccgggagcgcagggcgggcctggaagagctccgccccaaggggcgcggccaccccggaggcgggcgcacggctgcttctcattcattgtcttgacaagagcatcttcagcgggcgagtccccggctcctccagctccttcctcctcttcctcctcctcctccacctccggcttttgggggatcactgtcctctctcggcagcagaatgagccggcaggtggtccgctccagcaagttccgccacgtgtttggacagccggccaaggccgaccagtgctatgaagatgtgcgcgtctcacagaccacctgggacagtggcttctgtgctgtcaaccctaagtttgtggccctgatctgtgaggccagcgggggaggggccttcctggtgctgcccctgggcaagactggacgtgtggacaagaatgcgcccacggtctgtggccacacagcccctgtgctagacatcgcctggtgcccgcacaatgacaacgtcattgccagtggctccgaggactgcacagtcatggtgtgggagatcccagatgggggcctgatgctgcccctgcgggagcccgtcgtcaccctggagggccacaccaagcgtgtgggcattgtggcctggcacaccacagcccagaacgtgctgctcagtgcaggttgtgacaacgtgatcatggtgtgggacgtgggcactggggcggccatgctgacactgggcccagaggtgcacccagacacgatctacagtgtggactggagccgagatggaggcctcatttgtacctcctgccgtgacaagcgcgtgcgcatcatcgagccccgcaaaggcactgtcgtagctgagaaggaccgtccccacgaggggacccggcccgtgcgtgcagtgttcgtgtcggaggggaagatcctgaccacgggcttcagccgcatgagtgagcggcaggtggcgctgtgggacacaaagcacctggaggagccgctgtccctgcaggagctggacaccagcagcggtgtcctgctgcccttctttgaccctgacaccaacatcgtctacctctgtggcaagggtgacagctcaatccggtactttgagatcacttccgaggcccctttcctgcactatctctccatgttcagttccaaggagtcccagcggggcatgggctacatgcccaaacgtggcctggaggtgaacaagtgtgagatcgccaggttctacaagctgcacgagcggaggtgtgagcccattgccatgacagtgcctcgaaagtcggacctgttccaggaggacctgtacccacccaccgcagggcccgaccctgccctcacggctgaggagtggctggggggtcgggatgctgggcccctcctcatctccctcaaggatggctacgtacccccaaagagccgggagctgagggtcaaccggggcctggacaccgggcgcaggagggcagcaccagaggccagtggcactcccagctcggatgccgtgtctcggctggaggaggagatgcggaagctccaggccacggtgcaggagctccagaagcgcttggacaggctggaggagacagtccaggccaagtagagccccgcagggcctccagcagggtcagccattcacacccatccactcacctcccattcccagccacatggcagagaaaaaaatcataataaaatggctttattttctggtaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:11151 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:11151 -> Molecular function: GO:0008022 [protein C-terminus binding] evidence: IPI
GeneID:11151 -> Molecular function: GO:0008092 [cytoskeletal protein binding] evidence: ISS
GeneID:11151 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA
GeneID:11151 -> Molecular function: GO:0043548 [phosphatidylinositol 3-kinase binding] evidence: IDA
GeneID:11151 -> Molecular function: GO:0051015 [actin filament binding] evidence: IDA
GeneID:11151 -> Biological process: GO:0001845 [phagolysosome assembly] evidence: IMP
GeneID:11151 -> Biological process: GO:0006816 [calcium ion transport] evidence: IEA
GeneID:11151 -> Biological process: GO:0006909 [phagocytosis] evidence: IMP
GeneID:11151 -> Biological process: GO:0006928 [cellular component movement] evidence: NAS
GeneID:11151 -> Biological process: GO:0007015 [actin filament organization] evidence: IEA
GeneID:11151 -> Biological process: GO:0008360 [regulation of cell shape] evidence: IBA
GeneID:11151 -> Biological process: GO:0030036 [actin cytoskeleton organization] evidence: IMP
GeneID:11151 -> Biological process: GO:0030335 [positive regulation of cell migration] evidence: IEA
GeneID:11151 -> Biological process: GO:0030595 [leukocyte chemotaxis] evidence: IBA
GeneID:11151 -> Biological process: GO:0030833 [regulation of actin filament polymerization] evidence: IEA
GeneID:11151 -> Biological process: GO:0031589 [cell-substrate adhesion] evidence: IMP
GeneID:11151 -> Biological process: GO:0032796 [uropod organization] evidence: IBA
GeneID:11151 -> Biological process: GO:0042102 [positive regulation of T cell proliferation] evidence: IEA
GeneID:11151 -> Biological process: GO:0043029 [T cell homeostasis] evidence: IEA
GeneID:11151 -> Biological process: GO:0045087 [innate immune response] evidence: NAS
GeneID:11151 -> Biological process: GO:0048873 [homeostasis of number of cells within a tissue] evidence: IEA
GeneID:11151 -> Biological process: GO:0050918 [positive chemotaxis] evidence: IDA
GeneID:11151 -> Biological process: GO:0051126 [negative regulation of actin nucleation] evidence: IDA
GeneID:11151 -> Biological process: GO:0071353 [cellular response to interleukin-4] evidence: IEA
GeneID:11151 -> Cellular component: GO:0001772 [immunological synapse] evidence: IEA
GeneID:11151 -> Cellular component: GO:0001891 [phagocytic cup] evidence: IDA
GeneID:11151 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:11151 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:11151 -> Cellular component: GO:0005884 [actin filament] evidence: IDA
GeneID:11151 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
GeneID:11151 -> Cellular component: GO:0030027 [lamellipodium] evidence: IDA
GeneID:11151 -> Cellular component: GO:0030670 [phagocytic vesicle membrane] evidence: IEA
GeneID:11151 -> Cellular component: GO:0030864 [cortical actin cytoskeleton] evidence: IDA
GeneID:11151 -> Cellular component: GO:0043234 [protein complex] evidence: IDA
GeneID:11151 -> Cellular component: GO:0045335 [phagocytic vesicle] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.