Home |
Help |
Advanced search
2025-05-09 16:58:05, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001030047 1906 bp mRNA linear PRI 24-JUN-2013
DEFINITION Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript
variant 3, mRNA.
ACCESSION NM_001030047
VERSION NM_001030047.1 GI:71834852
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1906)
AUTHORS Helfand,B.T., Loeb,S., Hu,Q., Cooper,P.R., Roehl,K.A.,
McGuire,B.B., Baumann,N.A. and Catalona,W.J.
TITLE Personalized prostate specific antigen testing using genetic
variants may reduce unnecessary prostate biopsies
JOURNAL J. Urol. 189 (5), 1697-1701 (2013)
PUBMED 23246478
REMARK GeneRIF: Our results suggest that 4 single nucleotide polymorphisms
can be used to adjust a man's measured prostate specific antigen
concentration and potentially delay or prevent unnecessary prostate
biopsies in Caucasian men
REFERENCE 2 (bases 1 to 1906)
AUTHORS Shobana,R., Samal,S.K. and Elankumaran,S.
TITLE Prostate-specific antigen-retargeted recombinant newcastle disease
virus for prostate cancer virotherapy
JOURNAL J. Virol. 87 (7), 3792-3800 (2013)
PUBMED 23345509
REMARK GeneRIF: Prostate-specific antigen targeting is likely to enhance
the therapeutic index of recombinant Newcastle disease virus in
prostate cancer, owing to tumor-restricted replication and enhanced
fusogenicity.
REFERENCE 3 (bases 1 to 1906)
AUTHORS Sun,J., Tao,S., Gao,Y., Peng,T., Tan,A., Zhang,H., Yang,X., Qin,X.,
Hu,Y., Feng,J., Kim,S.T., Lin,X., Wu,Y., Zhang,J., Li,Z., Li,L.,
Mo,L., Liang,Z., Shi,D., Huang,Z., Huang,X., Liu,M., Liu,Q.,
Zhang,S., Lilly Zheng,S., Xu,J. and Mo,Z.
TITLE Genome-wide association study identified novel genetic variant on
SLC45A3 gene associated with serum levels prostate-specific antigen
(PSA) in a Chinese population
JOURNAL Hum. Genet. 132 (4), 423-429 (2013)
PUBMED 23269536
REMARK GeneRIF: Genome-wide association study identified novel genetic
variant on SLC45A3 gene associated with serum levels
prostate-specific antigen (PSA) in a Chinese population.
REFERENCE 4 (bases 1 to 1906)
AUTHORS Higashibata,T., Naito,M., Mori,A., Ozawa,N., Furuta,M.,
Tsuchiya,R., Koyama,E., Morita,E., Kawai,S., Okada,R., Yin,G.,
Wakai,K. and Hamajima,N.
TITLE DPP4 genetic variants influence baseline prostate-specific antigen
levels: the J-MICC study
JOURNAL Nagoya J Med Sci 75 (1-2), 73-80 (2013)
PUBMED 23544270
REMARK GeneRIF: DPP4 genetic variants influence baseline PSA levels,
especially in men aged between 60 and 69.
REFERENCE 5 (bases 1 to 1906)
AUTHORS Samzadeh,M., Hasanzad,M., Jamaldini,S.H., Haghdoost,A.A.,
Afshari,M. and Ziaee,S.A.
TITLE Association of G/A polymorphism, rs266882, in AREI region of the
prostate-specific antigen gene with prostate cancer risk and
clinicopathological features
JOURNAL Urol J 9 (4), 691-699 (2012)
PUBMED 23235975
REMARK GeneRIF: We found a significant positive association between the GG
genotype of PSA polymorphism and prostate cancer risk compared to
AG genotype. But no association was observed between alleles and
grade, stage, or age of diagnosis.
REFERENCE 6 (bases 1 to 1906)
AUTHORS Cohen,P., Graves,H.C., Peehl,D.M., Kamarei,M., Giudice,L.C. and
Rosenfeld,R.G.
TITLE Prostate-specific antigen (PSA) is an insulin-like growth factor
binding protein-3 protease found in seminal plasma
JOURNAL J. Clin. Endocrinol. Metab. 75 (4), 1046-1053 (1992)
PUBMED 1383255
REFERENCE 7 (bases 1 to 1906)
AUTHORS Espana,F., Gilabert,J., Estelles,A., Romeu,A., Aznar,J. and Cabo,A.
TITLE Functionally active protein C inhibitor/plasminogen activator
inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at
high concentrations in human seminal plasma and complexes with
prostate-specific antigen
JOURNAL Thromb. Res. 64 (3), 309-320 (1991)
PUBMED 1725227
REFERENCE 8 (bases 1 to 1906)
AUTHORS Christensson,A., Laurell,C.B. and Lilja,H.
TITLE Enzymatic activity of prostate-specific antigen and its reactions
with extracellular serine proteinase inhibitors
JOURNAL Eur. J. Biochem. 194 (3), 755-763 (1990)
PUBMED 1702714
REFERENCE 9 (bases 1 to 1906)
AUTHORS Lundwall,A. and Lilja,H.
TITLE Molecular cloning of human prostate specific antigen cDNA
JOURNAL FEBS Lett. 214 (2), 317-322 (1987)
PUBMED 2436946
REFERENCE 10 (bases 1 to 1906)
AUTHORS Watt,K.W., Lee,P.J., M'Timkulu,T., Chan,W.P. and Loor,R.
TITLE Human prostate-specific antigen: structural and functional
similarity with serine proteases
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (10), 3166-3170 (1986)
PUBMED 2422647
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC005307.1, M21896.1 and
AC011523.3.
Summary: Kallikreins are a subgroup of serine proteases having
diverse physiological functions. Growing evidence suggests that
many kallikreins are implicated in carcinogenesis and some have
potential as novel cancer and other disease biomarkers. This gene
is one of the fifteen kallikrein subfamily members located in a
cluster on chromosome 19. Its protein product is a protease present
in seminal plasma. It is thought to function normally in the
liquefaction of seminal coagulum, presumably by hydrolysis of the
high molecular mass seminal vesicle protein. Serum level of this
protein, called PSA in the clinical setting, is useful in the
diagnosis and monitoring of prostatic carcinoma. Alternate splicing
of this gene generates several transcript variants encoding
different isoforms. [provided by RefSeq, Jul 2008].
Transcript Variant: This variant (3) uses an alternate splice site
at the end of a coding exon, that causes a frameshift. The
resulting isoform (3) is shorter and has a distinct C-terminus
compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BU932434.1, M21896.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-52 BC005307.1 1-52
53-911 M21896.1 1-859
912-1906 AC011523.3 28192-29186
FEATURES Location/Qualifiers
source 1..1906
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.41"
gene 1..1906
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/note="kallikrein-related peptidase 3"
/db_xref="GeneID:354"
/db_xref="HGNC:6364"
/db_xref="HPRD:01461"
/db_xref="MIM:176820"
exon 1..87
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/inference="alignment:Splign:1.39.8"
variation 3
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:371797932"
variation 17
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:370025467"
variation 25
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:199680464"
variation 40
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:373854842"
CDS 42..758
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/EC_number="3.4.21.77"
/note="isoform 3 preproprotein is encoded by transcript
variant 3; gamma-seminoprotein; semenogelase; seminin;
P-30 antigen; prostate-specific antigen; prostate specific
antigen; kallikrein-3"
/codon_start=1
/product="prostate-specific antigen isoform 3
preproprotein"
/protein_id="NP_001025218.1"
/db_xref="GI:71834853"
/db_xref="CCDS:CCDS33083.1"
/db_xref="GeneID:354"
/db_xref="HGNC:6364"
/db_xref="HPRD:01461"
/db_xref="MIM:176820"
/translation="
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSWVILITELTMPALPMVLHGSLVPWRGGV
"
sig_peptide 42..92
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
proprotein 93..755
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/product="prostate-specific antigen isoform 3 proprotein"
mat_peptide 114..755
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/product="prostate-specific antigen isoform 3"
misc_feature 114..>671
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/note="Trypsin-like serine protease; Many of these are
synthesized as inactive precursor zymogens that are
cleaved during limited proteolysis to generate their
active forms. Alignment contains also inactive enzymes
that have substitutions of the catalytic triad...; Region:
Tryp_SPc; cd00190"
/db_xref="CDD:29152"
misc_feature 114..116
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/note="cleavage site"
/db_xref="CDD:29152"
misc_feature order(234..236,399..401)
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/note="active site"
/db_xref="CDD:29152"
variation 50
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:201712212"
variation 52
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:111689449"
variation 53
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:375104394"
variation 67
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="c"
/db_xref="dbSNP:368127664"
variation 73
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:138400533"
exon 88..247
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/inference="alignment:Splign:1.39.8"
variation 89..90
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:17849961"
variation 89
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:11573"
variation 91
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:181375335"
variation 95
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:1135766"
variation 111
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:141576693"
variation 112
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:147446084"
variation 115
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:375110405"
variation 122
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="c"
/db_xref="dbSNP:200846924"
variation 134
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:139911579"
variation 135
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:2271092"
variation 157
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="t"
/db_xref="dbSNP:200712655"
variation 158
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:7252245"
variation 169
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="c"
/db_xref="dbSNP:140318583"
variation 170
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/db_xref="dbSNP:374094231"
variation 175
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:139560851"
variation 183
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:149709822"
variation 187..188
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace=""
/replace="a"
/db_xref="dbSNP:34953540"
variation 191
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:144294681"
variation 194..195
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace=""
/replace="ggg"
/db_xref="dbSNP:375428882"
variation 194
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:201710884"
variation 195
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:369223448"
variation 237
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:371595805"
exon 248..534
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/inference="alignment:Splign:1.39.8"
variation 255
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:148892721"
variation 263
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:150517791"
variation 270
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:146422657"
variation 271
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:140831892"
variation 278
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:12946"
variation 279
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:17849962"
variation 300
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/db_xref="dbSNP:138565183"
STS 331..437
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/standard_name="PMC290276P4"
/db_xref="UniSTS:272424"
variation 341
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/db_xref="dbSNP:2739452"
variation 344
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:374344392"
variation 345
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:61752561"
variation 398
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:377532899"
variation 411
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:201390347"
variation 414
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:61750343"
variation 431
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:201110725"
variation 432
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:182759459"
variation 435
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="g"
/replace="t"
/db_xref="dbSNP:2003783"
variation 439
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:373661565"
variation 447
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:149427770"
variation 488
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:147547638"
variation 500
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:376483907"
variation 501
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:138273452"
variation 503..504
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace=""
/replace="t"
/db_xref="dbSNP:370161423"
variation 519
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="t"
/db_xref="dbSNP:200126385"
variation 525
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:112372888"
variation 530
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:143868213"
exon 535..671
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/inference="alignment:Splign:1.39.8"
variation 541
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:367976209"
variation 548..549
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace=""
/replace="a"
/db_xref="dbSNP:111850120"
variation 566
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:202206082"
variation 569
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/db_xref="dbSNP:148735869"
variation 572
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:372190695"
variation 577
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:17632542"
variation 587
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:372148450"
variation 588
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:150769385"
variation 596
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:376510386"
variation 615
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="g"
/replace="t"
/db_xref="dbSNP:376934756"
variation 629
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/db_xref="dbSNP:139172057"
variation 641
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1803129"
variation 644
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:370658603"
variation 646
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="g"
/replace="t"
/db_xref="dbSNP:187449592"
variation 647
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="g"
/replace="t"
/db_xref="dbSNP:191588971"
variation 649
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:146528783"
variation 670
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/db_xref="dbSNP:61729813"
exon 672..1906
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/inference="alignment:Splign:1.39.8"
variation 689
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:35192866"
variation 690
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:73932617"
variation 695
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:148839360"
variation 712
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:199786442"
variation 713
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:371037518"
variation 732
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:143518180"
variation 786
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:10401479"
variation 793
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:201907046"
variation 799
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:368022457"
variation 807
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:200639337"
variation 827
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:10401978"
variation 841
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:45588133"
variation 869..870
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace=""
/replace="c"
/db_xref="dbSNP:113002491"
variation 912
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:2659122"
STS 995..1117
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/standard_name="D19S1013"
/db_xref="UniSTS:68940"
variation 1002
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:3209092"
variation 1117
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:151298874"
variation 1146
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:140564011"
variation 1163
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:138882542"
variation 1164
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:61736309"
variation 1172
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:200116262"
variation 1182
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:79245399"
variation 1192
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="c"
/db_xref="dbSNP:144118163"
variation 1194
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:146297845"
variation 1195
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:372901531"
variation 1203
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:45552633"
variation 1209
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:113126792"
variation 1228
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1802720"
variation 1232
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:149376489"
variation 1250
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:144748315"
variation 1254
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:375475599"
variation 1255
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:200006942"
variation 1284
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1058205"
variation 1294
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:373134993"
variation 1299
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:374859717"
STS 1301..1531
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/standard_name="RH17676"
/db_xref="UniSTS:80100"
variation 1308
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:368035787"
variation 1319
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/db_xref="dbSNP:112479005"
variation 1328
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/db_xref="dbSNP:141498977"
variation 1334
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:1058274"
variation 1346
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="t"
/db_xref="dbSNP:1803132"
variation 1358
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1802722"
variation 1360
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1141894"
variation 1386
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:116064912"
variation 1393
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:1802721"
variation 1405
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:116248649"
variation 1406
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="c"
/db_xref="dbSNP:3180906"
variation 1431
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:16987771"
variation 1457
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1803138"
STS 1506..1670
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/standard_name="KLK3"
/db_xref="UniSTS:480246"
variation 1510
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/db_xref="dbSNP:190504941"
variation 1514
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:12101"
variation 1547
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:6998"
variation 1567..1568
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace=""
/replace="g"
/db_xref="dbSNP:112363170"
variation 1575
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="c"
/db_xref="dbSNP:16987775"
variation 1651
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1803136"
variation 1669
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:1803135"
variation 1677
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="g"
/replace="t"
/db_xref="dbSNP:370827372"
variation 1682
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:193123776"
variation 1684
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:377210991"
variation 1689
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1803134"
variation 1713
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:12040"
variation 1729
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:61269009"
variation 1766
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1803133"
variation 1773
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:11554029"
variation 1784
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:12863"
variation 1803
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="a"
/replace="g"
/db_xref="dbSNP:1803137"
variation 1808
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:11554028"
variation 1858
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
/replace="c"
/replace="t"
/db_xref="dbSNP:11554027"
polyA_signal 1885..1890
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
polyA_site 1906
/gene="KLK3"
/gene_synonym="APS; hK3; KLK2A1; PSA"
ORIGIN
agccccaagcttaccacctgcacccggagagctgtgtcaccatgtgggtcccggttgtcttcctcaccctgtccgtgacgtggattggtgctgcacccctcatcctgtctcggattgtgggaggctgggagtgcgagaagcattcccaaccctggcaggtgcttgtggcctctcgtggcagggcagtctgcggcggtgttctggtgcacccccagtgggtcctcacagctgcccactgcatcaggaacaaaagcgtgatcttgctgggtcggcacagcctgtttcatcctgaagacacaggccaggtatttcaggtcagccacagcttcccacacccgctctacgatatgagcctcctgaagaatcgattcctcaggccaggtgatgactccagccacgacctcatgctgctccgcctgtcagagcctgccgagctcacggatgctgtgaaggtcatggacctgcccacccaggagccagcactggggaccacctgctacgcctcaggctggggcagcattgaaccagaggagttcttgaccccaaagaaacttcagtgtgtggacctccatgttatttccaatgacgtgtgtgcgcaagttcaccctcagaaggtgaccaagttcatgctgtgtgctggacgctggacagggggcaaaagcacctgctcgtgggtcattctgatcaccgaactgaccatgccagccctgccgatggtcctccatggctccctagtgccctggagaggaggtgtctagtcagagagtagtcctggaaggtggcctctgtgaggagccacggggacagcatcctgcagatggtcctggcccttgtcccaccgacctgtctacaaggactgtcctcgtggaccctcccctctgcacaggagctggaccctgaagtcccttccccaccggccaggactggagcccctacccctctgttggaatccctgcccaccttcttctggaagtcggctctggagacatttctctcttcttccaaagctgggaactgctatctgttatctgcctgtccaggtctgaaagataggattgcccaggcagaaactgggactgacctatctcactctctccctgcttttacccttagggtgattctgggggcccacttgtctgtaatggtgtgcttcaaggtatcacgtcatggggcagtgaaccatgtgccctgcccgaaaggccttccctgtacaccaaggtggtgcattaccggaagtggatcaaggacaccatcgtggccaacccctgagcacccctatcaaccccctattgtagtaaacttggaaccttggaaatgaccaggccaagactcaagcctccccagttctactgacctttgtccttaggtgtgaggtccagggttgctaggaaaagaaatcagcagacacaggtgtagaccagagtgtttcttaaatggtgtaattttgtcctctctgtgtcctggggaatactggccatgcctggagacatatcactcaatttctctgaggacacagataggatggggtgtctgtgttatttgtggggtacagagatgaaagaggggtgggatccacactgagagagtggagagtgacatgtgctggacactgtccatgaagcactgagcagaagctggaggcacaacgcaccagacactcacagcaaggatggagctgaaaacataacccactctgtcctggaggcactgggaagcctagagaaggctgtgagccaaggagggagggtcttcctttggcatgggatggggatgaagtaaggagagggactggaccccctggaagctgattcactatggggggaggtgtattgaagtcctccagacaaccctcagatttgatgatttcctagtagaactcacagaaataaagagctgttatactgtg
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:354 -> Molecular function: GO:0004252 [serine-type endopeptidase activity] evidence: NAS
GeneID:354 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:354 -> Molecular function: GO:0008236 [serine-type peptidase activity] evidence: TAS
GeneID:354 -> Biological process: GO:0006508 [proteolysis] evidence: NAS
GeneID:354 -> Biological process: GO:0016525 [negative regulation of angiogenesis] evidence: NAS
GeneID:354 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS
GeneID:354 -> Cellular component: GO:0005576 [extracellular region] evidence: NAS
GeneID:354 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001025218 -> EC 3.4.21.77
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.