GGRNA Home | Help | Advanced search

2025-05-09 16:47:06, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001012512             842 bp    mRNA    linear   PRI 30-MAY-2013
DEFINITION  Homo sapiens gastrin-releasing peptide (GRP), transcript variant 2,
            mRNA.
ACCESSION   NM_001012512
VERSION     NM_001012512.1  GI:60498996
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 842)
  AUTHORS   Nordlund,M.S., Stieber,P., Brustugun,O.T., Warren,D.J. and Paus,E.
  TITLE     Characteristics and clinical validity of two immunoassays for
            ProGRP
  JOURNAL   Tumour Biol. 33 (4), 1105-1113 (2012)
   PUBMED   22399443
  REMARK    GeneRIF: Data indicate that progastrin-releasing peptide (proGRP)
            assays with both time-resolved immunofluorometric assay (TR-IFMA)
            and Advanced Life Science Institute (ALSI) ELISA showed good
            clinical validity.
REFERENCE   2  (bases 1 to 842)
  AUTHORS   Ono,A., Naito,T., Ito,I., Watanabe,R., Shukuya,T., Kenmotsu,H.,
            Tsuya,A., Nakamura,Y., Murakami,H., Kaira,K., Takahashi,T.,
            Kameya,T., Nakajima,T., Endo,M. and Yamamoto,N.
  TITLE     Correlations between serial pro-gastrin-releasing peptide and
            neuron-specific enolase levels, and the radiological response to
            treatment and survival of patients with small-cell lung cancer
  JOURNAL   Lung Cancer 76 (3), 439-444 (2012)
   PUBMED   22300752
  REMARK    GeneRIF: Percent changes in serum ProGRP showed better correlation
            to the sum of the tumor diameters (SOD) and prognostic impact than
            that of NSE.
REFERENCE   3  (bases 1 to 842)
  AUTHORS   Tattersall,M., Cordeaux,Y., Charnock-Jones,D.S. and Smith,G.C.
  TITLE     Expression of gastrin-releasing peptide is increased by prolonged
            stretch of human myometrium, and antagonists of its receptor
            inhibit contractility
  JOURNAL   J. Physiol. (Lond.) 590 (PT 9), 2081-2093 (2012)
   PUBMED   22411014
  REMARK    GeneRIF: Tonic stretch of human myometrium increases contractility
            and stimulates the expression of a known smooth muscle stimulatory
            agonist, GRP. GRP receptor antagonists attenuate the effect of
            stretch.
REFERENCE   4  (bases 1 to 842)
  AUTHORS   Patel,O., Clyde,D., Chang,M., Nordlund,M.S., Steel,R., Kemp,B.E.,
            Pritchard,D.M., Shulkes,A. and Baldwin,G.S.
  TITLE     Pro-GRP-derived peptides are expressed in colorectal cancer cells
            and tumors and are biologically active in vivo
  JOURNAL   Endocrinology 153 (3), 1082-1092 (2012)
   PUBMED   22202166
  REMARK    GeneRIF: nonamidated peptides derived from the C terminus of
            pro-GRP are expressed in significant quantities in colorectal
            cancer cell lines
REFERENCE   5  (bases 1 to 842)
  AUTHORS   Kim,S.Y., Kim,J.S., Hwang,S.H., Park,H.K., Lee,J.H., Lee,D.H.,
            Hah,S.S. and Park do,Y.
  TITLE     Progastrin-releasing peptide is a candidate marker for quality
            control in clinical sample processing and storage
  JOURNAL   Am. J. Clin. Pathol. 137 (2), 277-282 (2012)
   PUBMED   22261454
  REMARK    GeneRIF: Progastrin-releasing peptide cab be used as a marker for
            quality control in clinical sample processing and storage.
REFERENCE   6  (bases 1 to 842)
  AUTHORS   Baraniuk,J.N., Lundgren,J.D., Shelhamer,J.H. and Kaliner,M.A.
  TITLE     Gastrin releasing peptide (GRP) binding sites in human bronchi
  JOURNAL   Neuropeptides 21 (2), 81-84 (1992)
   PUBMED   1557184
REFERENCE   7  (bases 1 to 842)
  AUTHORS   Naylor,S.L., Sakaguchi,A.Y., Spindel,E. and Chin,W.W.
  TITLE     Human gastrin-releasing peptide gene is located on chromosome 18
  JOURNAL   Somat. Cell Mol. Genet. 13 (1), 87-91 (1987)
   PUBMED   3027902
REFERENCE   8  (bases 1 to 842)
  AUTHORS   Lebacq-Verheyden,A.M., Bertness,V., Kirsch,I., Hollis,G.F.,
            McBride,O.W. and Battey,J.
  TITLE     Human gastrin-releasing peptide gene maps to chromosome band 18q21
  JOURNAL   Somat. Cell Mol. Genet. 13 (1), 81-86 (1987)
   PUBMED   3027901
REFERENCE   9  (bases 1 to 842)
  AUTHORS   Sausville,E.A., Lebacq-Verheyden,A.M., Spindel,E.R., Cuttitta,F.,
            Gazdar,A.F. and Battey,J.F.
  TITLE     Expression of the gastrin-releasing peptide gene in human small
            cell lung cancer. Evidence for alternative processing resulting in
            three distinct mRNAs
  JOURNAL   J. Biol. Chem. 261 (5), 2451-2457 (1986)
   PUBMED   3003116
REFERENCE   10 (bases 1 to 842)
  AUTHORS   Spindel,E.R., Zilberberg,M.D., Habener,J.F. and Chin,W.W.
  TITLE     Two prohormones for gastrin-releasing peptide are encoded by two
            mRNAs differing by 19 nucleotides
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 83 (1), 19-23 (1986)
   PUBMED   3001723
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC004488.2 and W01859.1.
            
            Summary: This gene encodes a member of the bombesin-like family of
            gastrin-releasing peptides. Its preproprotein, following cleavage
            of a signal peptide, is further processed to produce either the 27
            aa gastrin-releasing peptide or the 10 aa neuromedin C. These
            smaller peptides regulate numerous functions of the
            gastrointestinal and central nervous systems, including release of
            gastrointestinal hormones, smooth muscle cell contraction, and
            epithelial cell proliferation. These peptides are also likely to
            play a role in human cancers of the lung, colon, stomach, pancreas,
            breast, and prostate. Alternative splicing results in multiple
            transcript variants encoding different isoforms. [provided by
            RefSeq, Jul 2008].
            
            Transcript Variant: This variant (2) uses an alternate in-frame
            splice site in the 3' coding region, compared to variant 1,
            resulting in a shorter protein (isoform 2). This variant has also
            been identified as 'splice isoform 3' and 'pro-gastrin releasing
            peptide type 2'.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: mixed/partial sample support ERS025082, ERS025084
                              [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-480               BC004488.2         1-480
            481-583             W01859.1           159-261
            584-842             BC004488.2         605-863
FEATURES             Location/Qualifiers
     source          1..842
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="18"
                     /map="18q21.1-q21.32"
     gene            1..842
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /note="gastrin-releasing peptide"
                     /db_xref="GeneID:2922"
                     /db_xref="HGNC:4605"
                     /db_xref="MIM:137260"
     exon            1..237
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /inference="alignment:Splign:1.39.8"
     CDS             99..524
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /note="isoform 2 preproprotein is encoded by transcript
                     variant 2; bombesin; neuromedin C; pre-progastrin
                     releasing peptide; prepro-GRP"
                     /codon_start=1
                     /product="gastrin-releasing peptide isoform 2
                     preproprotein"
                     /protein_id="NP_001012530.1"
                     /db_xref="GI:60498997"
                     /db_xref="CCDS:CCDS45877.1"
                     /db_xref="GeneID:2922"
                     /db_xref="HGNC:4605"
                     /db_xref="MIM:137260"
                     /translation="
MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKGSQREGRNPQLNQQ
"
     sig_peptide     99..167
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     proprotein      168..521
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /product="gastrin-releasing peptide proprotein"
     mat_peptide     168..248
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /product="gastrin-releasing peptide"
     misc_feature    207..209
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02667"
     misc_feature    213..215
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02667"
     misc_feature    216..218
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02667"
     misc_feature    219..260
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /note="Bombesin-like peptide; Region: Bombesin; pfam02044"
                     /db_xref="CDD:110990"
     mat_peptide     219..248
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /product="neuromedin C"
                     /exception="alternative processing"
     misc_feature    222..224
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     misc_feature    225..227
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     misc_feature    228..230
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     misc_feature    231..233
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     misc_feature    240..242
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="proteolytic cleavage site; modified site"
                     /db_xref="HPRD:02666"
     variation       108
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1062557"
     variation       116
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372288358"
     variation       132
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35957920"
     variation       149
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042431"
     exon            238..480
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /inference="alignment:Splign:1.39.8"
     variation       242
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199962860"
     variation       247
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368410424"
     variation       261
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375754489"
     variation       278
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146673900"
     variation       289
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143274265"
     variation       318
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374866055"
     variation       338
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377146993"
     variation       361
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368021851"
     variation       370
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371397932"
     variation       407
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375963114"
     variation       423
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148328512"
     variation       427
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200302824"
     variation       428
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:55796466"
     variation       461
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:15526"
     exon            481..827
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /inference="alignment:Splign:1.39.8"
     variation       492..495
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace=""
                     /replace="gaag"
                     /db_xref="dbSNP:149962068"
     variation       494
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185933795"
     variation       533
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376342645"
     STS             536..810
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /standard_name="D18S1265"
                     /db_xref="UniSTS:68109"
     STS             558..802
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /standard_name="STS-K02054"
                     /db_xref="UniSTS:9077"
     variation       562
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369600106"
     variation       595
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2742"
     variation       741
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144426024"
     variation       748
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1803673"
     variation       799
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3180482"
     polyA_signal    801..806
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
     variation       818
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:72956189"
     polyA_site      827
                     /gene="GRP"
                     /gene_synonym="BN; GRP-10; preproGRP; proGRP"
ORIGIN      
ccagcggctgcggcggcggagctcctccgaggtccgggtcaccagtctctgctcttcccagcctctccggcgcgctccaagggcttcccgtcgggaccatgcgcggccgtgagctcccgctggtcctgctggcgctggtcctctgcctggcgccccgggggcgagcggtcccgctgcctgcgggcggagggaccgtgctgaccaagatgtacccgcgcggcaaccactgggcggtggggcacttaatggggaaaaagagcacaggggagtcttcttctgtttctgagagagggagcctgaagcagcagctgagagagtacatcaggtgggaagaagctgcaaggaatttgctgggtctcatagaagcaaaggagaacagaaaccaccagccacctcaacccaaggccctgggcaatcagcagccttcgtgggattcagaggatagcagcaacttcaaagatgtaggttcaaaaggcaaaggttctcaacgtgaaggaaggaacccccagctgaaccagcaatgataatgatggcctctctcaaaagagaaaaacaaaacccctaagagactgcgttctgcaagcatcagttctacggatcatcaacaagatttccttgtgcaaaatatttgactattctgtatctttcatccttgactaaattcgtgattttcaagcagcatcttctggtttaaacttgtttgctgtgaacaattgtcgaaaagagtcttccaattaatgcttttttatatctaggctacctgttggttagattcaaggccccgagctgttaccattcacaataaaagcttaaacacattgtccaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:2922 -> Molecular function: GO:0005102 [receptor binding] evidence: NAS
            GeneID:2922 -> Molecular function: GO:0005184 [neuropeptide hormone activity] evidence: IDA
            GeneID:2922 -> Biological process: GO:0007165 [signal transduction] evidence: NAS
            GeneID:2922 -> Biological process: GO:0007218 [neuropeptide signaling pathway] evidence: IDA
            GeneID:2922 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
            GeneID:2922 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.