Home |
Help |
Advanced search
2025-05-09 16:27:10, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000613 1635 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens hemopexin (HPX), mRNA.
ACCESSION NM_000613
VERSION NM_000613.2 GI:227430291
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1635)
AUTHORS Hahl,P., Davis,T., Washburn,C., Rogers,J.T. and Smith,A.
TITLE Mechanisms of neuroprotection by hemopexin: modeling the control of
heme and iron homeostasis in brain neurons in inflammatory states
JOURNAL J. Neurochem. 125 (1), 89-101 (2013)
PUBMED 23350672
REMARK GeneRIF: hemopexin will be neuroprotective after traumatic brain
injury, with heme release in the CNS, and during the ensuing
inflammation.
REFERENCE 2 (bases 1 to 1635)
AUTHORS Zager,R.A., Johnson,A.C. and Becker,K.
TITLE Renal cortical hemopexin accumulation in response to acute kidney
injury
JOURNAL Am. J. Physiol. Renal Physiol. 303 (10), F1460-F1472 (2012)
PUBMED 22993068
REMARK GeneRIF: In sum, these data indicated that AKI-associated hepatic
stress generates Hpx, which gains renal tubule access.
REFERENCE 3 (bases 1 to 1635)
AUTHORS Lin,T., Sammy,F., Yang,H., Thundivalappil,S., Hellman,J.,
Tracey,K.J. and Warren,H.S.
TITLE Identification of hemopexin as an anti-inflammatory factor that
inhibits synergy of hemoglobin with HMGB1 in sterile and infectious
inflammation
JOURNAL J. Immunol. 189 (4), 2017-2022 (2012)
PUBMED 22772444
REMARK GeneRIF: The findings suggest that hemopexin can modulate the role
of hemoglobin in sterile and infectious inflammation
REFERENCE 4 (bases 1 to 1635)
AUTHORS Law,M.L., Cai,G.Y., Hartz,J.A., Jones,C. and Kao,F.T.
TITLE The hemopexin gene maps to the same location as the beta-globin
gene cluster on human chromosome 11
JOURNAL Genomics 3 (1), 48-52 (1988)
PUBMED 3220477
REFERENCE 5 (bases 1 to 1635)
AUTHORS Morgan,W.T., Alam,J., Deaciuc,V., Muster,P., Tatum,F.M. and
Smith,A.
TITLE Interaction of hemopexin with Sn-protoporphyrin IX, an inhibitor of
heme oxygenase. Role for hemopexin in hepatic uptake of
Sn-protoporphyrin IX and induction of mRNA for heme oxygenase
JOURNAL J. Biol. Chem. 263 (17), 8226-8231 (1988)
PUBMED 3372522
REFERENCE 6 (bases 1 to 1635)
AUTHORS Smith,A., Tatum,F.M., Muster,P., Burch,M.K. and Morgan,W.T.
TITLE Importance of ligand-induced conformational changes in hemopexin
for receptor-mediated heme transport
JOURNAL J. Biol. Chem. 263 (11), 5224-5229 (1988)
PUBMED 2833500
REFERENCE 7 (bases 1 to 1635)
AUTHORS Altruda,F., Poli,V., Restagno,G. and Silengo,L.
TITLE Structure of the human hemopexin gene and evidence for
intron-mediated evolution
JOURNAL J. Mol. Evol. 27 (2), 102-108 (1988)
PUBMED 2842511
REFERENCE 8 (bases 1 to 1635)
AUTHORS Taketani,S., Kohno,H., Naitoh,Y. and Tokunaga,R.
TITLE Isolation of the hemopexin receptor from human placenta
JOURNAL J. Biol. Chem. 262 (18), 8668-8671 (1987)
PUBMED 3036819
REFERENCE 9 (bases 1 to 1635)
AUTHORS Altruda,F., Poli,V., Restagno,G., Argos,P., Cortese,R. and
Silengo,L.
TITLE The primary structure of human hemopexin deduced from cDNA
sequence: evidence for internal, repeating homology
JOURNAL Nucleic Acids Res. 13 (11), 3841-3859 (1985)
PUBMED 2989777
REFERENCE 10 (bases 1 to 1635)
AUTHORS Takahashi,N., Takahashi,Y. and Putnam,F.W.
TITLE Complete amino acid sequence of human hemopexin, the heme-binding
protein of serum
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 82 (1), 73-77 (1985)
PUBMED 3855550
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC005395.1, AK313648.1,
AV655383.1 and AC084337.7.
On Apr 23, 2009 this sequence version replaced gi:11321560.
Summary: This gene encodes a plasma glycoprotein that binds heme
with high affinity. The encoded protein is an acute phase protein
that transports heme from the plasma to the liver and may be
involved in protecting cells from oxidative stress. [provided by
RefSeq, Apr 2009].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC005395.1, J03048.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-803 BC005395.1 1-803
804-823 AK313648.1 767-786
824-1609 BC005395.1 805-1590
1610-1621 AV655383.1 408-419
1622-1622 AC084337.7 19853-19853 c
1623-1635 AV655383.1 421-433
FEATURES Location/Qualifiers
source 1..1635
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11p15.5-p15.4"
gene 1..1635
/gene="HPX"
/gene_synonym="HX"
/note="hemopexin"
/db_xref="GeneID:3263"
/db_xref="HGNC:5171"
/db_xref="HPRD:00793"
/db_xref="MIM:142290"
exon 1..144
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
STS 54..237
/gene="HPX"
/gene_synonym="HX"
/standard_name="GDB:197845"
/db_xref="UniSTS:155963"
CDS 62..1450
/gene="HPX"
/gene_synonym="HX"
/EC_number="3.2.1.35"
/note="beta-1B-glycoprotein"
/codon_start=1
/product="hemopexin precursor"
/protein_id="NP_000604.1"
/db_xref="GI:11321561"
/db_xref="CCDS:CCDS7763.1"
/db_xref="GeneID:3263"
/db_xref="HGNC:5171"
/db_xref="HPRD:00793"
/db_xref="MIM:142290"
/translation="
MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH
"
sig_peptide 62..130
/gene="HPX"
/gene_synonym="HX"
mat_peptide 131..1447
/gene="HPX"
/gene_synonym="HX"
/product="hemopexin"
misc_feature 131..133
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 149..181
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P02790.2);
Region: O-glycosylated at one site"
misc_feature 200..754
/gene="HPX"
/gene_synonym="HX"
/note="Hemopexin-like repeats.; Hemopexin is a
heme-binding protein that transports heme to the liver.
Hemopexin-like repeats occur in vitronectin and some
matrix metalloproteinases family (matrixins). The HX
repeats of some matrixins bind tissue inhibitor of...;
Region: HX; cd00094"
/db_xref="CDD:28978"
misc_feature order(209..211,752..754)
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
/citation=[10]
misc_feature 218..340
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P02790.2);
Region: Hemopexin 1"
misc_feature order(230..232,236..238,353..355,359..361,491..493,
497..499,626..628,632..634)
/gene="HPX"
/gene_synonym="HX"
/note="Metal binding sites [ion binding]; metal-binding
site"
/db_xref="CDD:28978"
misc_feature 251..253
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 341..478
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P02790.2);
Region: Hemopexin 2"
misc_feature 479..613
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P02790.2);
Region: Hemopexin 3"
misc_feature order(506..508,521..523)
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
/citation=[10]
misc_feature 614..754
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P02790.2);
Region: Hemopexin 4"
misc_feature 620..622
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature order(623..625,659..661)
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
/citation=[10]
misc_feature 779..781
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 797..799
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 827..1441
/gene="HPX"
/gene_synonym="HX"
/note="Hemopexin-like repeats.; Hemopexin is a
heme-binding protein that transports heme to the liver.
Hemopexin-like repeats occur in vitronectin and some
matrix metalloproteinases family (matrixins). The HX
repeats of some matrixins bind tissue inhibitor of...;
Region: HX; cd00094"
/db_xref="CDD:28978"
misc_feature order(830..832,1439..1441)
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
/citation=[10]
misc_feature 836..973
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P02790.2);
Region: Hemopexin 5"
misc_feature order(851..853,857..859,986..988,992..994,1142..1144,
1148..1150,1271..1273,1277..1279)
/gene="HPX"
/gene_synonym="HX"
/note="Metal binding sites [ion binding]; metal-binding
site"
/db_xref="CDD:28978"
misc_feature 974..1117
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P02790.2);
Region: Hemopexin 6"
misc_feature 1130..1249
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P02790.2);
Region: Hemopexin 7"
misc_feature order(1157..1159,1283..1285)
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
/citation=[10]
misc_feature 1259..1411
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P02790.2);
Region: Hemopexin 8"
misc_feature order(1313..1315,1364..1366)
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
/citation=[10]
misc_feature 1418..1420
/gene="HPX"
/gene_synonym="HX"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
variation 80
/gene="HPX"
/gene_synonym="HX"
/replace="a"
/replace="g"
/db_xref="dbSNP:35899065"
exon 145..203
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
exon 204..275
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
exon 276..397
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
variation 308
/gene="HPX"
/gene_synonym="HX"
/replace="c"
/replace="t"
/db_xref="dbSNP:12117"
exon 398..551
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
exon 552..764
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
variation 595
/gene="HPX"
/gene_synonym="HX"
/replace="a"
/replace="g"
/db_xref="dbSNP:34273718"
variation 599
/gene="HPX"
/gene_synonym="HX"
/replace="c"
/replace="g"
/db_xref="dbSNP:36070033"
exon 765..896
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
variation 774
/gene="HPX"
/gene_synonym="HX"
/replace="a"
/replace="g"
/db_xref="dbSNP:34780512"
exon 897..1027
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
exon 1028..1190
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
exon 1191..1623
/gene="HPX"
/gene_synonym="HX"
/inference="alignment:Splign:1.39.8"
variation 1212
/gene="HPX"
/gene_synonym="HX"
/replace="a"
/replace="g"
/db_xref="dbSNP:201246235"
variation 1237
/gene="HPX"
/gene_synonym="HX"
/replace="a"
/replace="g"
/db_xref="dbSNP:34557454"
STS 1346..1560
/gene="HPX"
/gene_synonym="HX"
/standard_name="RH11711"
/db_xref="UniSTS:30348"
STS 1346..1477
/gene="HPX"
/gene_synonym="HX"
/standard_name="RH11711"
/db_xref="UniSTS:30348"
variation 1369
/gene="HPX"
/gene_synonym="HX"
/replace="a"
/replace="c"
/db_xref="dbSNP:1042547"
STS 1418..1560
/gene="HPX"
/gene_synonym="HX"
/standard_name="D11S4353"
/db_xref="UniSTS:30347"
STS 1418..1477
/gene="HPX"
/gene_synonym="HX"
/standard_name="D11S4353"
/db_xref="UniSTS:30347"
STS 1458..1580
/gene="HPX"
/gene_synonym="HX"
/standard_name="D11S4588"
/db_xref="UniSTS:68264"
STS 1541..1580
/gene="HPX"
/gene_synonym="HX"
/standard_name="D11S4588"
/db_xref="UniSTS:68264"
polyA_signal 1584..1589
/gene="HPX"
/gene_synonym="HX"
polyA_site 1620
/gene="HPX"
/gene_synonym="HX"
ORIGIN
aactctatatagggagttcaactggtcacccagagctgtcctgtggcctctgcagctcagcatggctagggtactgggagcacccgttgcactggggttgtggagcctatgctggtctctggccattgccacccctcttcctccgactagtgcccatgggaatgttgctgaaggcgagaccaagccagacccagacgtgactgaacgctgctcagatggctggagctttgatgctaccaccctggatgacaatggaaccatgctgttttttaaaggggagtttgtgtggaagagtcacaaatgggaccgggagttaatctcagagagatggaagaatttccccagccctgtggatgctgcattccgtcaaggtcacaacagtgtctttctgatcaagggggacaaagtctgggtataccctcctgaaaagaaggagaaaggatacccaaagttgctccaagatgaatttcctggaatcccatccccactggatgcagctgtggaatgtcaccgtggagaatgtcaagctgaaggcgtcctcttcttccaaggtgaccgcgagtggttctgggacttggctacgggaaccatgaaggagcgttcctggccagctgttgggaactgctcctctgccctgagatggctgggccgctactactgcttccagggtaaccaattcctgcgcttcgaccctgtcaggggagaggtgcctcccaggtacccgcgggatgtccgagactacttcatgccctgccctggcagaggccatggacacaggaatgggactggccatgggaacagtacccaccatggccctgagtatatgcgctgtagcccacatctagtcttgtctgcactgacgtctgacaaccatggtgccacctatgccttcagtgggacccactactggcgtctggacaccagccgggatggctggcatagctggcccattgctcatcagtggccccagggtccttcagcagtggatgctgccttttcctgggaagaaaaactctatctggtccagggcacccaggtatatgtcttcctgacaaagggaggctataccctagtaagcggttatccgaagcggctggagaaggaagtcgggacccctcatgggattatcctggactctgtggatgcggcctttatctgccctgggtcttctcggctccatatcatggcaggacggcggctgtggtggctggacctgaagtcaggagcccaagccacgtggacagagcttccttggccccatgagaaggtagacggagccttgtgtatggaaaagtcccttggccctaactcatgttccgccaatggtcccggcttgtacctcatccatggtcccaatttgtactgctacagtgatgtggagaaactgaatgcagccaaggcccttccgcaaccccagaatgtgaccagtctcctgggctgcactcactgaggggccttctgacatgagtctggcctggccccacctcctagttcctcataataaagacagattgcttcttcgcttctcactgaggggccttctgacatgagtctggcctggccccacctccccagtttctcataataaagacagattgcttcttcacttgaatcaagggacctaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3263 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:3263 -> Molecular function: GO:0015232 [heme transporter activity] evidence: TAS
GeneID:3263 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
GeneID:3263 -> Biological process: GO:0002639 [positive regulation of immunoglobulin production] evidence: IEA
GeneID:3263 -> Biological process: GO:0002925 [positive regulation of humoral immune response mediated by circulating immunoglobulin] evidence: IEA
GeneID:3263 -> Biological process: GO:0006879 [cellular iron ion homeostasis] evidence: TAS
GeneID:3263 -> Biological process: GO:0015886 [heme transport] evidence: TAS
GeneID:3263 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:3263 -> Biological process: GO:0020027 [hemoglobin metabolic process] evidence: IEA
GeneID:3263 -> Biological process: GO:0042168 [heme metabolic process] evidence: IEA
GeneID:3263 -> Biological process: GO:0042511 [positive regulation of tyrosine phosphorylation of Stat1 protein] evidence: IEA
GeneID:3263 -> Biological process: GO:0060335 [positive regulation of interferon-gamma-mediated signaling pathway] evidence: IEA
GeneID:3263 -> Cellular component: GO:0005576 [extracellular region] evidence: NAS
GeneID:3263 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
GeneID:3263 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
GeneID:3263 -> Cellular component: GO:0071682 [endocytic vesicle lumen] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_000604 -> EC 3.2.1.35
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.